SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIR022W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIR022W
Domain Number 1 Region: 37-114
Classification Level Classification E-value
Superfamily LexA/Signal peptidase 3.53e-10
Family LexA-related 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
endopeptidase activity 1.54 8.19
Biological Process IC (bits) H-Score
protein processing 1.807 95.82
protein localization to organelle 1.462 12.6
mitochondrial transport 1.906 11.27
cytoplasmic transport 1.347 10.66
peptide metabolic process 1.563 8.58
protein targeting 1.502 7.9
mitochondrion organization 1.553 6.71
protein localization to mitochondrion 2.237 5.28

Protein sequence

External link(s) Locus: YIR022W   Protein: S000001461
Sequence length 167
Comment SEC11 SGDID:S000001461, Chr IX from 398730-399233, Verified ORF, "18kDa catalytic subunit of the Signal Peptidase Complex (SPC; Spc1p, Spc2p, Spc3p, and Sec11p) which cleaves the signal sequence of proteins targeted to the endoplasmic reticulum"
Sequence
MNLRFELQKLLNVCFLFASAYMFWQGLAIATNSASPIVVVLSGSMEPAFQRGDILFLWNR
NTFNQVGDVVVYEVEGKQIPIVHRVLRQHNNHADKQFLLTKGDNNAGNDISLYANKKIYL
NKSKEIVGTVKGYFPQLGYITIWISENKYAKFALLGMLGLSALLGGE
Download sequence
Identical sequences A6ZVU2 B3LTI7 C7GLT4 C8ZAS4 E7KDY6 E7KQ01 E7LVX4 E7Q587 E7QG89 G2WFV0 H0GI35 N1P981 P15367 W7PR28 W7R140
YIR022W YIR022W YIR022W YIR022W YIR022W YIR022W YIR022W YIR022W 4932.YIR022W YIR022W SCRT_05157 YIR022W YIR022W YIR022W tr|A6ZVU2|A6ZVU2_YEAS7 YIR022W YIR022W YIR022W YIR022W YIR022W YIR022W YIR022W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]