SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIR036W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YIR036W-A
Domain Number - Region: 59-113
Classification Level Classification E-value
Superfamily L domain-like 0.0264
Family Polygalacturonase inhibiting protein PGIP 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YIR036W-A   Protein: S000028803
Sequence length 133
Comment YIR036W-A SGDID:S000028803, Chr IX from 422632-423033, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MLLPDFLHQRFHSRPVRDVEDTIDKFVCTVFSLQRLQTSFRSCYAVDDAFIVLFDNSFHQ
LQANPTGGTCNQNNLAHIPSLTDYKLFLLLLFATALISCIPSSFSALSFLATLRKRSKSE
KKREKTMRNSMLP
Download sequence
Identical sequences W7PFE1
YIR036W-A YIR036W-A YIR036W-A YIR036W-A YIR036W-A 4932.YIR036W-A YIR036W-A YIR036W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]