SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YIR036W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YIR036W-A
Domain Number - Region: 59-113
Classification Level Classification E-value
Superfamily L domain-like 0.0264
Family Polygalacturonase inhibiting protein PGIP 0.067
Further Details:      
 

Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YIR036W-A   Protein: S000028803
Sequence length 133
Comment YIR036W-A SGDID:S000028803, Chr IX from 422632-423033, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data"
Sequence
MLLPDFLHQRFHSRPVRDVEDTIDKFVCTVFSLQRLQTSFRSCYAVDDAFIVLFDNSFHQ
LQANPTGGTCNQNNLAHIPSLTDYKLFLLLLFATALISCIPSSFSALSFLATLRKRSKSE
KKREKTMRNSMLP
Download sequence
Identical sequences W7PFE1
YIR036W-A 4932.YIR036W-A YIR036W-A YIR036W-A YIR036W-A YIR036W-A YIR036W-A YIR036W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]