SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YJL015C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL015C   Protein: S000003552
Sequence length 124
Comment YJL015C SGDID:S000003552, Chr X from 407511-407137, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein; expression if heat-inducible; located in promoter region of essential CCT3 gene encoding a subunit of the cytosolic chaperonin Cct ring complex, overlaps ORF YJL016W"
Sequence
MITRYYRCFFDIMLSTHFIEWRFAIFFLRTMRHVKRKSLVLGWKYIISHKIISGYIWLYR
NCTTNIYTVCKFLRCGYICEELCNGRSTCDDRTFAHRTFVFMGVYLQLIHHISRFRTNIA
FITQ
Download sequence
Identical sequences 4932.YJL015C YTYst251 YJL015C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]