SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL015C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJL015C   Protein: S000003552
Sequence length 124
Comment YJL015C SGDID:S000003552, Chr X from 407511-407137, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein; expression if heat-inducible; located in promoter region of essential CCT3 gene encoding a subunit of the cytosolic chaperonin Cct ring complex, overlaps ORF YJL016W"
Sequence
MITRYYRCFFDIMLSTHFIEWRFAIFFLRTMRHVKRKSLVLGWKYIISHKIISGYIWLYR
NCTTNIYTVCKFLRCGYICEELCNGRSTCDDRTFAHRTFVFMGVYLQLIHHISRFRTNIA
FITQ
Download sequence
Identical sequences YJL015C 4932.YJL015C YTYst251

Jump to [ Top of page · Domain architecture · Domain assignment details ]