SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL020C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL020C
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily SH3-domain 8.4e-13
Family SH3-domain 0.0018
Further Details:      
 

Protein sequence

External link(s) Locus: YJL020C   Protein: S000003557
Sequence length 1157
Comment BBC1 SGDID:S000003557, Chr X from 402405-398932, reverse complement, Verified ORF, "Protein possibly involved in assembly of actin patches; interacts with an actin assembly factor Las17p and with the SH3 domains of Type I myosins Myo3p and Myo5p; localized predominantly to cortical actin patches"
Sequence
MSEPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFP
KSFVAVQGSEVGKEAESSPNTGSTEQRTIQPEVEQKDLPEPISPETKKETLSGPVPVPAA
TVPVPAATVPVPAATAVSAQVQHDSSSGNGERKVPMDSPKLKARLSMFNQDITEQVPLPK
STHLDLENIPVKKTIVADAPKYYVPPGIPTNDTSNLERKKSLKENEKKIVPEPINRAQVE
SGRIETENDQLKKDLPQMSLKERIALLQEQQRLQAAREEELLRKKAKLEQEHERSAVNKN
EPYTETEEAEENEKTEPKPEFTPETEHNEEPQMELLAHKEITKTSREADEGTNDIEKEQF
LDEYTKENQKVEESQADEARGENVAEESEIGYGHEDREGDNDEEKEEEDSEENRRAALRE
RMAKLSGASRFGAPVGFNPFGMASGVGNKPSEEPKKKQHKEKEEEEPEQLQELPRAIPVM
PFVDPSSNPFFRKSNLSEKNQPTETKTLDPHATTEHEQKQEHGTHAYHNLAAVDNAHPEY
SDHDSDEDTDDHEFEDANDGLRKHSMVEQAFQIGNNESENVNSGEKIYPQEPPISHRTAE
VSHDIENSSQNTTGNVLPVSSPQTRVARNGSINSLTKSISGENRRKSINEYHDTVSTNSS
ALTETAQDISMAAPAAPVLSKVSHPEDKVPPHPVPSAPSAPPVPSAPSVPSAPPVPPAPP
ALSAPSVPPVPPVPPVSSAPPALSAPSIPPVPPTPPAPPAPPAPLALPKHNEVEEHVKSS
APLPPVSEEYHPMPNTAPPLPRAPPVPPATFEFDSEPTATHSHTAPSPPPHQNVTASTPS
MMSTQQRVPTSVLSGAEKESRTLPPHVPSLTNRPVDSFHESDTTPKVASIRRSTTHDVGE
ISNNVKIEFNAQERWWINKSAPPAISNLKLNFLMEIDDHFISKRLHQKWVVRDFYFLFEN
YSQLRFSLTFNSTSPEKTVTTLQERFPSPVETQSARILDEYAQRFNAKVVEKSHSLINSH
IGAKNFVSQIVSEFKDEVIQPIGARTFGATILSYKPEEGIEQLMKSLQKIKPGDILVIRK
AKFEAHKKIGKNEIINVGMDSAAPYSSVVTDYDFTKNKFRVIENHEGKIIQNSYKLSHMK
SGKLKVFRIVARGYVGW
Download sequence
Identical sequences P47068
YJL020C YJL020C YJL020C 4932.YJL020C YJL020C YJL020C

Jump to [ Top of page · Domain architecture · Domain assignment details ]