SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL020C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL020C
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000084
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL020C   Protein: S000003557
Sequence length 1157
Comment BBC1 SGDID:S000003557, Chr X from 402405-398932, reverse complement, Verified ORF, "Protein possibly involved in assembly of actin patches; interacts with an actin assembly factor Las17p and with the SH3 domains of Type I myosins Myo3p and Myo5p; localized predominantly to cortical actin patches"
Sequence
MSEPEVPFKVVAQFPYKSDYEDDLNFEKDQEIIVTSVEDAEWYFGEYQDSNGDVIEGIFP
KSFVAVQGSEVGKEAESSPNTGSTEQRTIQPEVEQKDLPEPISPETKKETLSGPVPVPAA
TVPVPAATVPVPAATAVSAQVQHDSSSGNGERKVPMDSPKLKARLSMFNQDITEQVPLPK
STHLDLENIPVKKTIVADAPKYYVPPGIPTNDTSNLERKKSLKENEKKIVPEPINRAQVE
SGRIETENDQLKKDLPQMSLKERIALLQEQQRLQAAREEELLRKKAKLEQEHERSAVNKN
EPYTETEEAEENEKTEPKPEFTPETEHNEEPQMELLAHKEITKTSREADEGTNDIEKEQF
LDEYTKENQKVEESQADEARGENVAEESEIGYGHEDREGDNDEEKEEEDSEENRRAALRE
RMAKLSGASRFGAPVGFNPFGMASGVGNKPSEEPKKKQHKEKEEEEPEQLQELPRAIPVM
PFVDPSSNPFFRKSNLSEKNQPTETKTLDPHATTEHEQKQEHGTHAYHNLAAVDNAHPEY
SDHDSDEDTDDHEFEDANDGLRKHSMVEQAFQIGNNESENVNSGEKIYPQEPPISHRTAE
VSHDIENSSQNTTGNVLPVSSPQTRVARNGSINSLTKSISGENRRKSINEYHDTVSTNSS
ALTETAQDISMAAPAAPVLSKVSHPEDKVPPHPVPSAPSAPPVPSAPSVPSAPPVPPAPP
ALSAPSVPPVPPVPPVSSAPPALSAPSIPPVPPTPPAPPAPPAPLALPKHNEVEEHVKSS
APLPPVSEEYHPMPNTAPPLPRAPPVPPATFEFDSEPTATHSHTAPSPPPHQNVTASTPS
MMSTQQRVPTSVLSGAEKESRTLPPHVPSLTNRPVDSFHESDTTPKVASIRRSTTHDVGE
ISNNVKIEFNAQERWWINKSAPPAISNLKLNFLMEIDDHFISKRLHQKWVVRDFYFLFEN
YSQLRFSLTFNSTSPEKTVTTLQERFPSPVETQSARILDEYAQRFNAKVVEKSHSLINSH
IGAKNFVSQIVSEFKDEVIQPIGARTFGATILSYKPEEGIEQLMKSLQKIKPGDILVIRK
AKFEAHKKIGKNEIINVGMDSAAPYSSVVTDYDFTKNKFRVIENHEGKIIQNSYKLSHMK
SGKLKVFRIVARGYVGW
Download sequence
Identical sequences N1P0Y5 P47068
4932.YJL020C YJL020C YJL020C YJL020C YJL020C YJL020C NP_012514.2.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]