SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL020W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJL020W-A   Protein: S000028659
Sequence length 85
Comment YJL020W-A SGDID:S000028659, Chr X from 400976-401233, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the verified gene YJL020C/BBC1"
Sequence
MARGSSWSCSGSSSSFSLCCFFFGSSDGLFPTPEAIPKGLKPTGAPNLLAPDSLAILSLN
AALRFSSLSSSSFSSSLSPSLSSWP
Download sequence
Identical sequences C8ZBD9 Q8TGN2
YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A 4932.YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A YJL020W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]