SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL026C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJL026C-A   Protein: S000028660
Sequence length 73
Comment YJL026C-A SGDID:S000028660, Chr X from 393282-393061, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the verified gene YJL026W/RNR2"
Sequence
MAGSGLFFKWANNKHAKSVCKPSSLQINSLEKVKPGIIPLFFNQKMEAKEPEKKTPSMEA
KATSLSPNKASAS
Download sequence
Identical sequences C8ZBI8 Q8TGJ8
YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A 4932.YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A YJL026C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]