SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL026W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL026W
Domain Number 1 Region: 31-359
Classification Level Classification E-value
Superfamily Ferritin-like 7.57e-113
Family Ribonucleotide reductase-like 0.00000000000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cytosol 1.295 64.93
fusome 2.182 15.07
oxidoreductase complex 1.828 13.98
plastid 1.525 4.44

Protein sequence

External link(s) Locus: YJL026W   Protein: S000003563
Sequence length 399
Comment RNR2 SGDID:S000003563, Chr X from 392399-393598, Verified ORF, "Ribonucleotide-diphosphate reductase (RNR), small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits"
Sequence
MPKETPSKAAADALSDLEIKDSKSNLNKELETLREENRVKSDMLKEKLSKDAENHKAYLK
SHQVHRHKLKEMEKEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIH
DWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHS
ETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRWIQDADALFGERLVAFASIEG
VFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEKIV
TEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKVENPFDFMENI
SLAGKTNFFEKRVSDYQKAGVMSKSTKQEAGAFTFNEDF
Download sequence
Identical sequences N1NZY1 P09938
4932.YJL026W YJL026W ISFI293 1smqA YJL026w___KOG1567 YJL026W YJL026W 1smq.A 1smq.B 1smq.C 1smq.D YJL026W YJL026W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]