SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL026W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL026W
Domain Number 1 Region: 31-359
Classification Level Classification E-value
Superfamily Ferritin-like 7.57e-113
Family Ribonucleotide reductase-like 6.46e-12
Further Details:      
 

Protein sequence

External link(s) Locus: YJL026W   Protein: S000003563
Sequence length 399
Comment RNR2 SGDID:S000003563, Chr X from 392399-393598, Verified ORF, "Ribonucleotide-diphosphate reductase (RNR), small subunit; the RNR complex catalyzes the rate-limiting step in dNTP synthesis and is regulated by DNA replication and DNA damage checkpoint pathways via localization of the small subunits"
Sequence
MPKETPSKAAADALSDLEIKDSKSNLNKELETLREENRVKSDMLKEKLSKDAENHKAYLK
SHQVHRHKLKEMEKEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIH
DWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHS
ETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRWIQDADALFGERLVAFASIEG
VFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEKIV
TEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKVENPFDFMENI
SLAGKTNFFEKRVSDYQKAGVMSKSTKQEAGAFTFNEDF
Download sequence
Identical sequences N1NZY1 P09938
YJL026W 1smqA 4932.YJL026W YJL026W YJL026W YJL026W 1smq.A 1smq.B 1smq.C 1smq.D YJL026w___KOG1567 ISFI293 YJL026W

Jump to [ Top of page · Domain architecture · Domain assignment details ]