SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL031C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL031C
Domain Number 1 Region: 1-323
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 6.15e-71
Family Protein prenylyltransferase 1.31e-05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
transferase activity, transferring alkyl or aryl (other than methyl) groups 2.083 68.53
Rab GTPase binding 2.138 45.58
GTPase binding 1.685 25.89
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
protein targeting to membrane 1.891 7.17
protein targeting 1.502 7.17

Protein sequence

External link(s) Locus: YJL031C   Protein: S000003568
Sequence length 327
Comment BET4 SGDID:S000003568, Chr X from 387433-387431,387343-386363, reverse complement, Verified ORF, "Alpha subunit of Type II geranylgeranyltransferase required for vesicular transport between the endoplasmic reticulum and the Golgi; provides a membrane attachment moiety to Rab-like proteins Ypt1p and Sec4p"
Sequence
MHGIKRKQWTKELLRQKRVQDEKKIYDYRSLTENVLNMRDEKIYSIEALKKTSELLEKNP
EFNAIWNYRRDIIASLASELEIPFWDKELVFVMMLLKDYPKVYWIWNHRLWVLKHYPTSS
PKVWQTELAVVNKLLEQDARNYHGWHYRRIVVGNIESITNKSLDKEEFEYTTIKINNNIS
NYSAWHQRVQIISRMFQKGEVGNQKEYIRTEISYIINAMFTDAEDQSVWFYIKWFIKNDI
VCKTLDEQEYLKMLKDLRENILLINNDEIEFSGKQNIWCLKILLVLEDILEEKEALTERS
SEQYLVQLIDADPLRKNRYLHLLEQHK
Download sequence
Identical sequences A6ZPU4 C8ZBC8 Q00618 W7PEF6 W7RJ40
YJL031C YJL031C YJL031C YJL031C YJL031C YJL031C YJL031C YJL031C YJL031C 4932.YJL031C YJL031C YJL031C YJL031C tr|A6ZPU4|A6ZPU4_YEAS7 YJL031C YJL031C YJL031C YJL031C YJL031C YJL031C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]