SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL031C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL031C
Domain Number 1 Region: 1-323
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 6.15e-71
Family Protein prenylyltransferase 1.31e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YJL031C   Protein: S000003568
Sequence length 327
Comment BET4 SGDID:S000003568, Chr X from 387433-387431,387343-386363, reverse complement, Verified ORF, "Alpha subunit of Type II geranylgeranyltransferase required for vesicular transport between the endoplasmic reticulum and the Golgi; provides a membrane attachment moiety to Rab-like proteins Ypt1p and Sec4p"
Sequence
MHGIKRKQWTKELLRQKRVQDEKKIYDYRSLTENVLNMRDEKIYSIEALKKTSELLEKNP
EFNAIWNYRRDIIASLASELEIPFWDKELVFVMMLLKDYPKVYWIWNHRLWVLKHYPTSS
PKVWQTELAVVNKLLEQDARNYHGWHYRRIVVGNIESITNKSLDKEEFEYTTIKINNNIS
NYSAWHQRVQIISRMFQKGEVGNQKEYIRTEISYIINAMFTDAEDQSVWFYIKWFIKNDI
VCKTLDEQEYLKMLKDLRENILLINNDEIEFSGKQNIWCLKILLVLEDILEEKEALTERS
SEQYLVQLIDADPLRKNRYLHLLEQHK
Download sequence
Identical sequences A6ZPU4 C8ZBC8 Q00618
YJL031C YJL031C YJL031C YJL031C YJL031C YJL031C YJL031C YJL031C YJL031C 4932.YJL031C YJL031C YJL031C YJL031C tr|A6ZPU4|A6ZPU4_YEAS7 YJL031C YJL031C YJL031C YJL031C YJL031C YJL031C

Jump to [ Top of page · Domain architecture · Domain assignment details ]