SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YJL058C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL058C   Protein: S000003594
Sequence length 543
Comment BIT61 SGDID:S000003594, Chr X from 327868-326237, reverse complement, Verified ORF, "Subunit of TORC2 (Tor2p-Lst8p-Avo1-Avo2-Tsc11p-Bit61p-Slm1p-Slm2p), a membrane-associated complex that regulates cell cycle-dependent actin cytoskeletal dynamics during polarized growth and cell wall integrity"
Sequence
MTAEDILLRERTSTTTQRPVNSEQYLNVQLATAPVKNFQTTSEISRQTLVDTSNDDVYSI
KNLKGSRNPISPSVSNVGFQSIFHTVDHPRSKVSVASNHSLRSNDNASAATSKSGSSQIG
ESHSVDTVECSNNLSKKLSSDAISITQKSLHSTPSGRYMKGKASGFFNRRNRAHTTISSD
PASFLTDSSTLHNSSHSFRNVIKNFFQNKSHRHIGQDAIEPAIPNSLSKFLHSSYGRHKS
PSQFIHTNAGQLVDSGTSVYSLNVNPSGVNPNTIVEDPLSGTDPASPNPVSMLHDLLRNL
PSLEANYKHFNSQELTTLTNNIWNIFCSNVAELFRTQRIWKLRAKIENFNEVLEFYCILK
TDPRVTHSGMNRIISDLKEFLVSSLYNLENQIVFNYSNEDTINNALKRLGVIWRIFYQEV
YYDLAAVLLPLDQSIREDGNSTVLKSGNESRTHINGNYSIGFLLLMCFRDSIVLPCYENF
VNSNDGISKSFQLYIFNQEEESNVTETDKLTLLQCFGILSTIQSNDRNQRIIEELLAGIR
MSI
Download sequence
Identical sequences G2WGV8 N1P0V7 P47041
YJL058C YJL058C YR243 YJL058C YJL058C YJL058C 4932.YJL058C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]