SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL058C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJL058C   Protein: S000003594
Sequence length 543
Comment BIT61 SGDID:S000003594, Chr X from 327868-326237, reverse complement, Verified ORF, "Subunit of TORC2 (Tor2p-Lst8p-Avo1-Avo2-Tsc11p-Bit61p-Slm1p-Slm2p), a membrane-associated complex that regulates cell cycle-dependent actin cytoskeletal dynamics during polarized growth and cell wall integrity"
Sequence
MTAEDILLRERTSTTTQRPVNSEQYLNVQLATAPVKNFQTTSEISRQTLVDTSNDDVYSI
KNLKGSRNPISPSVSNVGFQSIFHTVDHPRSKVSVASNHSLRSNDNASAATSKSGSSQIG
ESHSVDTVECSNNLSKKLSSDAISITQKSLHSTPSGRYMKGKASGFFNRRNRAHTTISSD
PASFLTDSSTLHNSSHSFRNVIKNFFQNKSHRHIGQDAIEPAIPNSLSKFLHSSYGRHKS
PSQFIHTNAGQLVDSGTSVYSLNVNPSGVNPNTIVEDPLSGTDPASPNPVSMLHDLLRNL
PSLEANYKHFNSQELTTLTNNIWNIFCSNVAELFRTQRIWKLRAKIENFNEVLEFYCILK
TDPRVTHSGMNRIISDLKEFLVSSLYNLENQIVFNYSNEDTINNALKRLGVIWRIFYQEV
YYDLAAVLLPLDQSIREDGNSTVLKSGNESRTHINGNYSIGFLLLMCFRDSIVLPCYENF
VNSNDGISKSFQLYIFNQEEESNVTETDKLTLLQCFGILSTIQSNDRNQRIIEELLAGIR
MSI
Download sequence
Identical sequences G2WGV8 P47041
YJL058C YJL058C 4932.YJL058C YJL058C YR243 YJL058C YJL058C

Jump to [ Top of page · Domain architecture · Domain assignment details ]