SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL069C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL069C
Domain Number 1 Region: 247-592
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.59e-32
Family WD40-repeat 0.045
Further Details:      
 

Protein sequence

External link(s) Locus: YJL069C   Protein: S000003605
Sequence length 594
Comment UTP18 SGDID:S000003605, Chr X from 312701-310917, reverse complement, Verified ORF, "Possible U3 snoRNP protein involved in maturation of pre-18S rRNA, based on computational analysis of large-scale protein-protein interaction data"
Sequence
MTMATTAMNVSVPPPDEEEQLLAKFVFGDTTDLQENLAKFNADFIFNEQEMDVEDQEDEG
SESDNSEEDEAQNGELDHVNNDQLFFVDDGGNEDSQDKNEDTMDVDDEDDSSSDDYSEDS
EEAAWIDSDDEKIKVPILVTNKTKKLRTSYNESKINGVHYINRLRSQFEKIYPRPKWVDD
ESDSELDDEEDDEEEGSNNVINGDINALTKILSTTYNYKDTLSNSKLLPPKKLDIVRLKD
ANASHPSHSAIQSLSFHPSKPLLLTGGYDKTLRIYHIDGKTNHLVTSLHLVGSPIQTCTF
YTSLSNQNQQNIFTAGRRRYMHSWDLSLENLTHSQTAKIEKFSRLYGHESTQRSFENFKV
AHLQNSQTNSVHGIVLLQGNNGWINILHSTSGLWLMGCKIEGVITDFCIDYQPISRGKFR
TILIAVNAYGEVWEFDLNKNGHVIRRWKDQGGVGITKIQVGGGTTTTCPALQISKIKQNR
WLAVGSESGFVNLYDRNNAMTSSTPTPVAALDQLTTTISNLQFSPDGQILCMASRAVKDA
LRLVHLPSCSVFSNWPTSGTPLGKVTSVAFSPSGGLLAVGNEQGKVRLWKLNHY
Download sequence
Identical sequences E7QGJ2 P40362
YJL069C YJL069C YJL069C 4932.YJL069C YJL069C YJL069C

Jump to [ Top of page · Domain architecture · Domain assignment details ]