SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL069C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL069C
Domain Number 1 Region: 247-592
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.59e-32
Family WD40-repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.917 41.05
nucleolus 1.641 36.88
methyltransferase complex 2.218 18.65
cilium 1.573 18.45
transcription factor complex 1.912 12.5
chromosomal part 1.477 12.4
cytoplasmic vesicle part 1.73 10.22
cytoplasmic vesicle membrane 1.912 10.22
SWI/SNF superfamily-type complex 2.178 9.97
ciliary part 1.844 9.85

Protein sequence

External link(s) Locus: YJL069C   Protein: S000003605
Sequence length 594
Comment UTP18 SGDID:S000003605, Chr X from 312701-310917, reverse complement, Verified ORF, "Possible U3 snoRNP protein involved in maturation of pre-18S rRNA, based on computational analysis of large-scale protein-protein interaction data"
Sequence
MTMATTAMNVSVPPPDEEEQLLAKFVFGDTTDLQENLAKFNADFIFNEQEMDVEDQEDEG
SESDNSEEDEAQNGELDHVNNDQLFFVDDGGNEDSQDKNEDTMDVDDEDDSSSDDYSEDS
EEAAWIDSDDEKIKVPILVTNKTKKLRTSYNESKINGVHYINRLRSQFEKIYPRPKWVDD
ESDSELDDEEDDEEEGSNNVINGDINALTKILSTTYNYKDTLSNSKLLPPKKLDIVRLKD
ANASHPSHSAIQSLSFHPSKPLLLTGGYDKTLRIYHIDGKTNHLVTSLHLVGSPIQTCTF
YTSLSNQNQQNIFTAGRRRYMHSWDLSLENLTHSQTAKIEKFSRLYGHESTQRSFENFKV
AHLQNSQTNSVHGIVLLQGNNGWINILHSTSGLWLMGCKIEGVITDFCIDYQPISRGKFR
TILIAVNAYGEVWEFDLNKNGHVIRRWKDQGGVGITKIQVGGGTTTTCPALQISKIKQNR
WLAVGSESGFVNLYDRNNAMTSSTPTPVAALDQLTTTISNLQFSPDGQILCMASRAVKDA
LRLVHLPSCSVFSNWPTSGTPLGKVTSVAFSPSGGLLAVGNEQGKVRLWKLNHY
Download sequence
Identical sequences E7QGJ2 N1P341 P40362
YJL069C YJL069C YJL069C YJL069C 4932.YJL069C YJL069C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]