SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL084C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL084C
Domain Number 1 Region: 263-353
Classification Level Classification E-value
Superfamily E set domains 0.0000301
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
receptor complex 1.511 25.85
extracellular space 1.521 23.93
integral component of plasma membrane 1.462 16.92
transferase complex 1.423 15.55
cation channel complex 2.046 9.35
cell cortex 1.627 8.48
transcription factor complex 1.912 8.24
cilium 1.573 6.04
nonmotile primary cilium 1.962 6.04
actin filament 2.159 5.27

Protein sequence

External link(s) Locus: YJL084C   Protein: S000003620
Sequence length 1046
Comment ALY2 SGDID:S000003620, Chr X from 277997-274857, reverse complement, Verified ORF, "Cytoplasmic protein of unknown function that interacts with the cyclin Pcl7p; phosphorylated in vitro by the cyclin-CDK complex, Pcl7p-Pho85p; identified as a potential Cdc28p substrate; mRNA is cell cycle regulated, peaking in M phase"
Sequence
MPMDQSISSPLFPMEKDIDIPLDATPLAQSSSLQLFIHLAEPVVFLQGFDPQKTEYPSVV
LRGCLVVRILKPTKLKSISLSFKGYSRTEWPEGIPPKRQEFVEIKDIVDHTWALYPPTEQ
KSKKKMDASAPNESNNAANNFLTKESGASLYRTLSDNETITSRKNSISGLSSLNLSPLGA
PGNSSVNVKDRESRQRSRSSSVTSSNGPSRNLSPINLLKRATSPSVSHHNYKPTTTSIFS
DLLNNTFTHNDAASHHGHHIPTSSNHLAMTSNNFTSGSGGEFFVFQPGDYIYAFEELIPQ
AYPESIKADFGFVEYFLFASIERPGAFKSNISARQVVNIVRTQAHNSVEESEPIIISRDW
ENQLYYDIVIASKDIILDAFLPITFKFAPLDKVTLHRIRIYVTETMEYYCREKKVHRMEP
TKKFLLTEQKGPKLPNLPNDANLSKAKNMGNLLQDPKNGDLVNKEYEYQIFIPSRFNNHQ
QLHPDTSYENIKANHWIKICLRLSRVVDNKRKHYEISIDSPIHVLHRLCSHANTLLPSYD
GHPASFPKETDSSISSILESSDDNINLYHNSNIFFPKEVLSSPVLSPNVQPLDILIPHLP
STSLTRNSRQFNRNSKSHPSDNTIFNSAKLKSNIYQPESLQRELASPQAIPLSPITSPMS
NMEVPPPDFDFSSDFISDAASGTTTTEVSSSESSILPRDPPSYKDTVLHDNNQKRRPNSK
HPTPPSLKASHPNKNSDKNSSETLNKKESMSKIEENKHKRETTPKKRENRDVKSLSTPQR
EESKDSTSTGNQSNEKNRKRVLSLSSSLHSSPNNSGFAHSALGNLSNESLRSLNRRESVQ
DNLPSTIRHDNPFFTDLNQVLIEDELKNHDKNELNRHSTNTSSTPASARSSFDYSGINIS
KDKLNMEPLLSKTETLTNKVNEDSFLRPNDSYVDLLEPSVDTTIDITAPYARNSSAWHPL
QNDNDNNQFSPLLGSNENFLNAANAQNSAESDHNNDIFTQGSGLTESSKNSDSEERFISR
LSSPEKVLINTLDNESGLQSINESTL
Download sequence
Identical sequences N1P331 P47029
YJL084C 4932.YJL084C YJL084C YJL084C YJL084C YJL084C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]