SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL084C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL084C
Domain Number 1 Region: 263-353
Classification Level Classification E-value
Superfamily E set domains 3.01e-05
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Protein sequence

External link(s) Locus: YJL084C   Protein: S000003620
Sequence length 1046
Comment ALY2 SGDID:S000003620, Chr X from 277997-274857, reverse complement, Verified ORF, "Cytoplasmic protein of unknown function that interacts with the cyclin Pcl7p; phosphorylated in vitro by the cyclin-CDK complex, Pcl7p-Pho85p; identified as a potential Cdc28p substrate; mRNA is cell cycle regulated, peaking in M phase"
Sequence
MPMDQSISSPLFPMEKDIDIPLDATPLAQSSSLQLFIHLAEPVVFLQGFDPQKTEYPSVV
LRGCLVVRILKPTKLKSISLSFKGYSRTEWPEGIPPKRQEFVEIKDIVDHTWALYPPTEQ
KSKKKMDASAPNESNNAANNFLTKESGASLYRTLSDNETITSRKNSISGLSSLNLSPLGA
PGNSSVNVKDRESRQRSRSSSVTSSNGPSRNLSPINLLKRATSPSVSHHNYKPTTTSIFS
DLLNNTFTHNDAASHHGHHIPTSSNHLAMTSNNFTSGSGGEFFVFQPGDYIYAFEELIPQ
AYPESIKADFGFVEYFLFASIERPGAFKSNISARQVVNIVRTQAHNSVEESEPIIISRDW
ENQLYYDIVIASKDIILDAFLPITFKFAPLDKVTLHRIRIYVTETMEYYCREKKVHRMEP
TKKFLLTEQKGPKLPNLPNDANLSKAKNMGNLLQDPKNGDLVNKEYEYQIFIPSRFNNHQ
QLHPDTSYENIKANHWIKICLRLSRVVDNKRKHYEISIDSPIHVLHRLCSHANTLLPSYD
GHPASFPKETDSSISSILESSDDNINLYHNSNIFFPKEVLSSPVLSPNVQPLDILIPHLP
STSLTRNSRQFNRNSKSHPSDNTIFNSAKLKSNIYQPESLQRELASPQAIPLSPITSPMS
NMEVPPPDFDFSSDFISDAASGTTTTEVSSSESSILPRDPPSYKDTVLHDNNQKRRPNSK
HPTPPSLKASHPNKNSDKNSSETLNKKESMSKIEENKHKRETTPKKRENRDVKSLSTPQR
EESKDSTSTGNQSNEKNRKRVLSLSSSLHSSPNNSGFAHSALGNLSNESLRSLNRRESVQ
DNLPSTIRHDNPFFTDLNQVLIEDELKNHDKNELNRHSTNTSSTPASARSSFDYSGINIS
KDKLNMEPLLSKTETLTNKVNEDSFLRPNDSYVDLLEPSVDTTIDITAPYARNSSAWHPL
QNDNDNNQFSPLLGSNENFLNAANAQNSAESDHNNDIFTQGSGLTESSKNSDSEERFISR
LSSPEKVLINTLDNESGLQSINESTL
Download sequence
Identical sequences P47029
YJL084C YJL084C 4932.YJL084C YJL084C YJL084C YJL084C

Jump to [ Top of page · Domain architecture · Domain assignment details ]