SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL084C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL084C
Domain Number 1 Region: 263-353
Classification Level Classification E-value
Superfamily E set domains 0.0000301
Family Arrestin/Vps26-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
extracellular space 1.265 24.89
receptor complex 1.424 18.13
integral component of plasma membrane 1.383 16.65
transporter complex 1.655 16.65
plasma membrane protein complex 1.484 16.65
plastid 1.489 16.11
transferase complex 1.334 15.99
cytoplasmic region 1.531 11.2
potassium channel complex 2.119 8.93
intracellular ribonucleoprotein complex 1.329 8.26

Protein sequence

External link(s) Locus: YJL084C   Protein: S000003620
Sequence length 1046
Comment ALY2 SGDID:S000003620, Chr X from 277997-274857, reverse complement, Verified ORF, "Cytoplasmic protein of unknown function that interacts with the cyclin Pcl7p; phosphorylated in vitro by the cyclin-CDK complex, Pcl7p-Pho85p; identified as a potential Cdc28p substrate; mRNA is cell cycle regulated, peaking in M phase"
Sequence
MPMDQSISSPLFPMEKDIDIPLDATPLAQSSSLQLFIHLAEPVVFLQGFDPQKTEYPSVV
LRGCLVVRILKPTKLKSISLSFKGYSRTEWPEGIPPKRQEFVEIKDIVDHTWALYPPTEQ
KSKKKMDASAPNESNNAANNFLTKESGASLYRTLSDNETITSRKNSISGLSSLNLSPLGA
PGNSSVNVKDRESRQRSRSSSVTSSNGPSRNLSPINLLKRATSPSVSHHNYKPTTTSIFS
DLLNNTFTHNDAASHHGHHIPTSSNHLAMTSNNFTSGSGGEFFVFQPGDYIYAFEELIPQ
AYPESIKADFGFVEYFLFASIERPGAFKSNISARQVVNIVRTQAHNSVEESEPIIISRDW
ENQLYYDIVIASKDIILDAFLPITFKFAPLDKVTLHRIRIYVTETMEYYCREKKVHRMEP
TKKFLLTEQKGPKLPNLPNDANLSKAKNMGNLLQDPKNGDLVNKEYEYQIFIPSRFNNHQ
QLHPDTSYENIKANHWIKICLRLSRVVDNKRKHYEISIDSPIHVLHRLCSHANTLLPSYD
GHPASFPKETDSSISSILESSDDNINLYHNSNIFFPKEVLSSPVLSPNVQPLDILIPHLP
STSLTRNSRQFNRNSKSHPSDNTIFNSAKLKSNIYQPESLQRELASPQAIPLSPITSPMS
NMEVPPPDFDFSSDFISDAASGTTTTEVSSSESSILPRDPPSYKDTVLHDNNQKRRPNSK
HPTPPSLKASHPNKNSDKNSSETLNKKESMSKIEENKHKRETTPKKRENRDVKSLSTPQR
EESKDSTSTGNQSNEKNRKRVLSLSSSLHSSPNNSGFAHSALGNLSNESLRSLNRRESVQ
DNLPSTIRHDNPFFTDLNQVLIEDELKNHDKNELNRHSTNTSSTPASARSSFDYSGINIS
KDKLNMEPLLSKTETLTNKVNEDSFLRPNDSYVDLLEPSVDTTIDITAPYARNSSAWHPL
QNDNDNNQFSPLLGSNENFLNAANAQNSAESDHNNDIFTQGSGLTESSKNSDSEERFISR
LSSPEKVLINTLDNESGLQSINESTL
Download sequence
Identical sequences N1P331 P47029
YJL084C 4932.YJL084C YJL084C YJL084C YJL084C YJL084C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]