SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL090C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL090C
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily BRCT domain 1.21e-09
Family DNA ligase 0.037
Further Details:      
 
Domain Number 2 Region: 171-220
Classification Level Classification E-value
Superfamily BRCT domain 1.74e-09
Family DNA-repair protein XRCC1 0.061
Further Details:      
 
Domain Number 3 Region: 102-162,193-215
Classification Level Classification E-value
Superfamily BRCT domain 1.83e-06
Family DNA-repair protein XRCC1 0.056
Further Details:      
 
Domain Number 4 Region: 326-412
Classification Level Classification E-value
Superfamily BRCT domain 7.72e-06
Family DNA-repair protein XRCC1 0.035
Further Details:      
 
Weak hits

Sequence:  YJL090C
Domain Number - Region: 441-495,545-567
Classification Level Classification E-value
Superfamily BRCT domain 0.00837
Family DNA ligase 0.062
Further Details:      
 

Most Informative Gene Ontologies

Protein sequence

External link(s) Locus: YJL090C   Protein: S000003626
Sequence length 764
Comment DPB11 SGDID:S000003626, Chr X from 265046-262752, reverse complement, Verified ORF, "Subunit of DNA Polymerase II Epsilon complex; has BRCT domain, required on the prereplicative complex at replication origins for loading DNA polymerases to initiate DNA synthesis, also required for S/M checkpoint control"
Sequence
MKPFQGITFCPTAINNEILAKKISKKIIKLGGIFSKDLTRQVNVLVVGSTTNTNKFKFAV
KHRFDIIFIDIQAIDDIYQLWLSGENILPDSNTATMTGSTYEMLKILYRRFSFKYLHNFN
IFIGRITDTNITSIDSLVRSIKKLGCSSYNYQNFVIKDTSSHNDDDDQGQNGQISIFVTD
TLLGARVNAAIEQNIPIVHFKWILDCQKRSALLPYDPYYLLPNIKDLPYDSIGSNSCDCW
DKINTTFPTNIDAQSSLQRQQSSSTLTPSLPKTSSLLNKFKPKGEKIWDKAMSLQQHSKT
NFSVLGQSPLSINNKQEDLSDNSTLIFKNCAFIIHHIFPGNHRSILTKIVVQNGGKIETS
YLSGIYDHSYYIIPSNKALDSFNDLPEIIDDNDGIVTEFFIERCLYYQKLLHPIDLWSKP
FLSTIEFQVSSSSKLLHHEFSSSPFLNVTITGFSGVELLHLTKVLNLLKPMGINYVEYLN
KSTDILLINLAALPSIPKTHPLWSNEFSDLFTQFCINNNNDDPGDNNRKDFQNNSILRNS
MKRKIEYIKKFHSIPVVTPAFIFKLLSAASGENNEIFLNNIKWCIICPRGHKDDFKCKIK
KPYYTSISSEKKYQNNDPKIDKTILLKRNNSSLSEHSMKDTKNELLQKIRETDSGRKKRS
VSSSIMDVSSERQMPDTKRIKLESLPKNFVPKQIKRTTSWGTIMSENVPTEQPTAISNPE
EIPRTEEVSHTQVTYGSIQDKKRTASLEKPMRRQTRNQTKELDS
Download sequence
Identical sequences N1P327 P47027
YJL090C YJL090C 4932.YJL090C YJL090C YJL090C YJL090C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]