SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YJL090C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL090C
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000121
Family DNA ligase 0.037
Further Details:      
 
Domain Number 2 Region: 171-220
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000174
Family DNA-repair protein XRCC1 0.061
Further Details:      
 
Domain Number 3 Region: 102-162,193-215
Classification Level Classification E-value
Superfamily BRCT domain 0.00000183
Family DNA-repair protein XRCC1 0.056
Further Details:      
 
Domain Number 4 Region: 326-412
Classification Level Classification E-value
Superfamily BRCT domain 0.00000772
Family DNA-repair protein XRCC1 0.035
Further Details:      
 
Weak hits

Sequence:  YJL090C
Domain Number - Region: 441-495,545-567
Classification Level Classification E-value
Superfamily BRCT domain 0.00837
Family DNA ligase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribonucleoprotein complex 1.418 21.16
ubiquitin ligase complex 1.933 7.75
cell cortex 1.63 7.31
SWI/SNF superfamily-type complex 2.178 7.08
chromosomal part 1.477 5.9
replication fork 2.198 5.74
methyltransferase complex 2.218 5.44
microtubule cytoskeleton 1.334 4.88
nuclear chromosome 1.72 4.8
condensed chromosome 2.188 4.8

Protein sequence

External link(s) Locus: YJL090C   Protein: S000003626
Sequence length 764
Comment DPB11 SGDID:S000003626, Chr X from 265046-262752, reverse complement, Verified ORF, "Subunit of DNA Polymerase II Epsilon complex; has BRCT domain, required on the prereplicative complex at replication origins for loading DNA polymerases to initiate DNA synthesis, also required for S/M checkpoint control"
Sequence
MKPFQGITFCPTAINNEILAKKISKKIIKLGGIFSKDLTRQVNVLVVGSTTNTNKFKFAV
KHRFDIIFIDIQAIDDIYQLWLSGENILPDSNTATMTGSTYEMLKILYRRFSFKYLHNFN
IFIGRITDTNITSIDSLVRSIKKLGCSSYNYQNFVIKDTSSHNDDDDQGQNGQISIFVTD
TLLGARVNAAIEQNIPIVHFKWILDCQKRSALLPYDPYYLLPNIKDLPYDSIGSNSCDCW
DKINTTFPTNIDAQSSLQRQQSSSTLTPSLPKTSSLLNKFKPKGEKIWDKAMSLQQHSKT
NFSVLGQSPLSINNKQEDLSDNSTLIFKNCAFIIHHIFPGNHRSILTKIVVQNGGKIETS
YLSGIYDHSYYIIPSNKALDSFNDLPEIIDDNDGIVTEFFIERCLYYQKLLHPIDLWSKP
FLSTIEFQVSSSSKLLHHEFSSSPFLNVTITGFSGVELLHLTKVLNLLKPMGINYVEYLN
KSTDILLINLAALPSIPKTHPLWSNEFSDLFTQFCINNNNDDPGDNNRKDFQNNSILRNS
MKRKIEYIKKFHSIPVVTPAFIFKLLSAASGENNEIFLNNIKWCIICPRGHKDDFKCKIK
KPYYTSISSEKKYQNNDPKIDKTILLKRNNSSLSEHSMKDTKNELLQKIRETDSGRKKRS
VSSSIMDVSSERQMPDTKRIKLESLPKNFVPKQIKRTTSWGTIMSENVPTEQPTAISNPE
EIPRTEEVSHTQVTYGSIQDKKRTASLEKPMRRQTRNQTKELDS
Download sequence
Identical sequences N1P327 P47027
YJL090C YJL090C YJL090C YJL090C 4932.YJL090C YJL090C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]