SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL092W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL092W
Domain Number 1 Region: 11-569,643-681,711-749
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-116
Family Tandem AAA-ATPase domain 9.83e-07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.999 25.69
chromosomal part 1.477 20.41
nucleoplasm part 1.418 15.58
endosome 1.325 14.24
cilium 1.611 13.15
extrinsic to plasma membrane 1.992 12.72
internal side of plasma membrane 2.099 12.51
extracellular organelle 1.593 12.36
ribonucleoprotein complex 1.418 9.43
transcription factor complex 1.882 9.42

Protein sequence

External link(s) Locus: YJL092W   Protein: S000003628
Sequence length 1174
Comment SRS2 SGDID:S000003628, Chr X from 257418-260942, Verified ORF, "DNA helicase and DNA-dependent ATPase involved in DNA repair, needed for proper timing of commitment to meiotic recombination and transition from Meiosis I to II; affects genome stability by suppressing unscheduled homologous recombination"
Sequence
MSSNNDLWLHLVSQLNTQQRAAALFDYTRGLQVIAGPGTGKTKVLTSRVAYLILHHHIHP
RDIIVTTFTNKAANEMKERLQEMLRGAGVNISELLIGTFHSICLKILYRFGHLVDLQKDW
RIIDEKEIDVILDDMIEKVPDQIRDYASSITRKVNLCMPSKNGDEWTIHPKLIKKQISKL
KSNAILPEEYILDSNHDAALGYFYQIYQSELSKKNTLDFDDLLMYTFRLLTRVRVLSNIK
HVLVDEFQDTNGIQLDLMFLFAKGNHHLSRGMTIVGDPDQSIYAFRNALAHNFLEMGRKC
PIEYSTIILVENYRSSQKILNTSEILITQQNKGRQNRAPLRAQFDLDFPPVYMNFPAYFL
EAPSLVRELLYLKALPNLFTFNDFAILVRQRRQIKRIESALIEHRIPYKIIRGHSFWDSK
ETRAMLNLLKLIFSPNDKHAILASLLYPARGLGPATGEKIKNALDTLATDVSCFQILKDI
SSKKIMLDIPTKGRSVIADFISMIENCQLLLQSTLLGGLSDLFDKLYELSGLKYEYLYKD
GKKKNDQLEKSEPNLLNARHKNIELLKNYFLALLSKSESSDKEKNEAIKAATDEAEPIEN
KVITPKEYLRNFFNSLSLHSDAAEEEESESNKDAKIKREKNGFVTISTIHGAKGLEWPVV
FIPGCEEGIIPCVFNDDKKDESEEDEEEDQENSKKDASPKKTRVLSVEDSIDEERRMFFV
AQTRAKYLLYLSNTVTVEDVDRPRIASRFLTTDLIKAMSDSQKLFESTNSIKKLYRILNK
KPPAEDDKLFSLDQLRKDYNQFIENRRERMIWQGIQMNDVYGIQLSRNKLLGSVSDFTSA
ADQLRLETQNSIFPQKKLIEKSRPSKINGNYAPKSRVKSPEKRYAPETTSFHSPTKKKVY
APQYVSTTNVPSRQEFHSSTGKNIPFLRREDRSITDISPRSSTRSLKGASPNKTSHMSDD
LMRPSPTRKDKVTRNIHFATAGTFRIETQSNVDELHPPEYSNKSGQSLTSSEFSGFSSAC
SNSDQPTNLIEDINNELDLSDEELLNDISIERRRELLGSKKTKKIKPKTRNRKSKRGDKV
KVEEVIDLKSEFEEDDSRNTTAAELLHNPDDTTVDNRPIISNAKFLADAAMKKTQKFSKK
VKNEPASSQMDIFSQLSRAKKKSKLNNGEIIVID
Download sequence
Identical sequences N1P8F3 P12954
YJL092W YJL092W 4932.YJL092W YJL092W YJL092W YJL092W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]