SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL092W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL092W
Domain Number 1 Region: 11-569,643-681,711-749
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.15e-116
Family Tandem AAA-ATPase domain 0.000000983
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.332 27.17
transporter complex 1.655 21.75
cilium 1.616 21.53
chromosomal part 1.456 20.39
ciliary part 1.785 20.28
midbody 2.192 17.88
side of membrane 1.587 15.98
protein-DNA complex 1.891 15.71
endosome 1.317 12.57
plasma membrane protein complex 1.484 10.85

Protein sequence

External link(s) Locus: YJL092W   Protein: S000003628
Sequence length 1174
Comment SRS2 SGDID:S000003628, Chr X from 257418-260942, Verified ORF, "DNA helicase and DNA-dependent ATPase involved in DNA repair, needed for proper timing of commitment to meiotic recombination and transition from Meiosis I to II; affects genome stability by suppressing unscheduled homologous recombination"
Sequence
MSSNNDLWLHLVSQLNTQQRAAALFDYTRGLQVIAGPGTGKTKVLTSRVAYLILHHHIHP
RDIIVTTFTNKAANEMKERLQEMLRGAGVNISELLIGTFHSICLKILYRFGHLVDLQKDW
RIIDEKEIDVILDDMIEKVPDQIRDYASSITRKVNLCMPSKNGDEWTIHPKLIKKQISKL
KSNAILPEEYILDSNHDAALGYFYQIYQSELSKKNTLDFDDLLMYTFRLLTRVRVLSNIK
HVLVDEFQDTNGIQLDLMFLFAKGNHHLSRGMTIVGDPDQSIYAFRNALAHNFLEMGRKC
PIEYSTIILVENYRSSQKILNTSEILITQQNKGRQNRAPLRAQFDLDFPPVYMNFPAYFL
EAPSLVRELLYLKALPNLFTFNDFAILVRQRRQIKRIESALIEHRIPYKIIRGHSFWDSK
ETRAMLNLLKLIFSPNDKHAILASLLYPARGLGPATGEKIKNALDTLATDVSCFQILKDI
SSKKIMLDIPTKGRSVIADFISMIENCQLLLQSTLLGGLSDLFDKLYELSGLKYEYLYKD
GKKKNDQLEKSEPNLLNARHKNIELLKNYFLALLSKSESSDKEKNEAIKAATDEAEPIEN
KVITPKEYLRNFFNSLSLHSDAAEEEESESNKDAKIKREKNGFVTISTIHGAKGLEWPVV
FIPGCEEGIIPCVFNDDKKDESEEDEEEDQENSKKDASPKKTRVLSVEDSIDEERRMFFV
AQTRAKYLLYLSNTVTVEDVDRPRIASRFLTTDLIKAMSDSQKLFESTNSIKKLYRILNK
KPPAEDDKLFSLDQLRKDYNQFIENRRERMIWQGIQMNDVYGIQLSRNKLLGSVSDFTSA
ADQLRLETQNSIFPQKKLIEKSRPSKINGNYAPKSRVKSPEKRYAPETTSFHSPTKKKVY
APQYVSTTNVPSRQEFHSSTGKNIPFLRREDRSITDISPRSSTRSLKGASPNKTSHMSDD
LMRPSPTRKDKVTRNIHFATAGTFRIETQSNVDELHPPEYSNKSGQSLTSSEFSGFSSAC
SNSDQPTNLIEDINNELDLSDEELLNDISIERRRELLGSKKTKKIKPKTRNRKSKRGDKV
KVEEVIDLKSEFEEDDSRNTTAAELLHNPDDTTVDNRPIISNAKFLADAAMKKTQKFSKK
VKNEPASSQMDIFSQLSRAKKKSKLNNGEIIVID
Download sequence
Identical sequences N1P8F3 P12954
YJL092W YJL092W YJL092W 4932.YJL092W YJL092W YJL092W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]