SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL114W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJL114W   Protein: S000003650
Sequence length 414
Comment YJL114W SGDID:S000003650, Chr X from 197913-199157, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MATPVRGETRNVIDDNISARIQSKVKTNDTVRQTPSSLRKVSIKDEQVRQYQRNLNRFKT
ILNGLKAEEEKLSEADDIQMLAEKLLKLGETIDKVENRIVDLVEKIQLLETNENNNILHE
HIDATGTYYLFDTLTSTNKRFYPKDCVFDYRTNNVENIPILLNNFKKFIKKYQFDDVFEN
DIIEIDPRENEILCKIIKEGLGESLDIMNTNTTDIFRIIDGLKKQNIEVCMVEMSELEPG
EKVLVDTTCRNSALLMNKLQKLVLMEKWIFSKCCQDCPNLKDYLQEAIMGTLHESLRNSV
KQRLYNIPHDVGIDHEEFLINTVIETVIDLSPIADDQIENSCMYCKSVFHCSINCKKKPN
RELRPDSTNFSKTYYLQGAQRQQPLKSSAKRTKVLEQDTKKVEQSVQQQKTGNY
Download sequence
Identical sequences P47023
YJL114W 4932.YJL114W

Jump to [ Top of page · Domain architecture · Domain assignment details ]