SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL114W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL114W   Protein: S000003650
Sequence length 414
Comment YJL114W SGDID:S000003650, Chr X from 197913-199157, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MATPVRGETRNVIDDNISARIQSKVKTNDTVRQTPSSLRKVSIKDEQVRQYQRNLNRFKT
ILNGLKAEEEKLSEADDIQMLAEKLLKLGETIDKVENRIVDLVEKIQLLETNENNNILHE
HIDATGTYYLFDTLTSTNKRFYPKDCVFDYRTNNVENIPILLNNFKKFIKKYQFDDVFEN
DIIEIDPRENEILCKIIKEGLGESLDIMNTNTTDIFRIIDGLKKQNIEVCMVEMSELEPG
EKVLVDTTCRNSALLMNKLQKLVLMEKWIFSKCCQDCPNLKDYLQEAIMGTLHESLRNSV
KQRLYNIPHDVGIDHEEFLINTVIETVIDLSPIADDQIENSCMYCKSVFHCSINCKKKPN
RELRPDSTNFSKTYYLQGAQRQQPLKSSAKRTKVLEQDTKKVEQSVQQQKTGNY
Download sequence
Identical sequences P47023
4932.YJL114W YJL114W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]