SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YJL121C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL121C
Domain Number 1 Region: 1-228
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.71e-64
Family D-ribulose-5-phosphate 3-epimerase 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
plastid 1.6 7.5
cytosol 1.305 3.35

Protein sequence

External link(s) Locus: YJL121C   Protein: S000003657
Sequence length 238
Comment RPE1 SGDID:S000003657, Chr X from 191089-190373, reverse complement, Verified ORF, "D-ribulose-5-phosphate 3-epimerase, catalyzes a reaction in the non-oxidative part of the pentose-phosphate pathway; mutants are sensitive to oxidative stress"
Sequence
MVKPIIAPSILASDFANLGCECHKVINAGADWLHIDVMDGHFVPNITLGQPIVTSLRRSV
PRPGDASNTEKKPTAFFDCHMMVENPEKWVDDFAKCGADQFTFHYEATQDPLHLVKLIKS
KGIKAACAIKPGTSVDVLFELAPHLDMALVMTVEPGFGGQKFMEDMMPKVETLRAKFPHL
NIQVDGGLGKETIPKAAKAGANVIVAGTSVFTAADPHDVISFMKEEVSKELRSRDLLD
Download sequence
Identical sequences A6ZQL0 B3LPZ8 C7GQ07 C8ZB98 E7KQ95 E7LW40 E7QGF8 H0GI84 N1P417 P46969 W7PRG2 W7QX00
YJL121C NYSGXRC-P002 YJL121C YJL121C 4932.YJL121C YJL121C YJL121C YJL121C YJL121C YJL121C YJL121C YJL121C YJL121C YJL121C SCRT_03555 YJL121C tr|A6ZQL0|A6ZQL0_YEAS7 YJL121C YJL121C YJL121C YJL121C YJL121C YJL121C YJL121C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]