SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL127C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL127C
Domain Number 1 Region: 162-268
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.88e-09
Family N-acetyl transferase, NAT 0.016
Further Details:      
 

Protein sequence

External link(s) Locus: YJL127C   Protein: S000003663
Sequence length 640
Comment SPT10 SGDID:S000003663, Chr X from 184218-182296, reverse complement, Verified ORF, "Putative histone acetylase, sequence-specific activator of histone genes, binds specifically and highly cooperatively to pairs of UAS elements in core histone promoters, functions at or near the TATA box"
Sequence
MLNQHTSSVPDDEHLQMAHQNSSSEVRNEAAVPDQLLTPLQPYTILLKDGETIATMYPIP
AYPDLLPLGLLNFLLDEFNMEVEKGDSFPYYETLSLEEFKNVWFHNDGHVCIMVLGEIPE
LDYSMDTEADTNDNFGTEIETTKHTTQYKKRKERRNLNLSMQWEKQCLGIFDLKPAYPGR
SAHVVTGTFLVNAGIRGKGIGKTLMETFIEWSKKLGFTSSFFPLIYGTNVGIRRILEGLN
FRRIGKLPEAGILKGFDVPVDSFMYGKEFTHITKSIDLLRDPQKSIEIGKYERLKHFLET
GKYPLHCDRNEKARLRVLSKTHSVLNGKLMTKGKEIIYDTDQQIQIALEIHLMEHLGINK
VTSKIGEKYHWRGIKSTVSEVISRCQKCKMRYKDGTGVIIEQKRAVKQAHMLPTQHIETI
NNPRKSKKHDNALLGQAINFPQNIISSTLNDVEGEPTPPDTNIVQPTFQNATNSPATTAE
ANEANKRSEFLSSIQSTPLLDDEQSMNSFNRFVEEENSRKRRKYLDVASNGIVPHLTNNE
SQDHANPVNRDERDMNHSVPDLDRNDHTIMNDAMLSLEDNVMAALEMVQKEQQQKINHRG
EDVTGQQIDLNNSEGNENSVTKIVNNESNTFTEHNSNIYY
Download sequence
Identical sequences P35208
YJL127C YJL127C 4932.YJL127C YJL127C YJL127C

Jump to [ Top of page · Domain architecture · Domain assignment details ]