SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YJL127W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL127W-A   Protein: S000007612
Sequence length 38
Comment YJL127W-A SGDID:S000007612, Chr X from 180191-180307, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MTLMSGEGQGKSSSVKRVPTIAATLVFFFSNSFLPASR
Download sequence
Identical sequences C8ZB37 P0C5P1 W7Q0R2
YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A 4932.YJL127W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]