SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL127W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJL127W-A   Protein: S000007612
Sequence length 38
Comment YJL127W-A SGDID:S000007612, Chr X from 180191-180307, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MTLMSGEGQGKSSSVKRVPTIAATLVFFFSNSFLPASR
Download sequence
Identical sequences C8ZB37 P0C5P1 W7Q0R2
YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A 4932.YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A YJL127W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]