SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL136C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL136C   Protein: S000003672
Sequence length 87
Comment RPS21B SGDID:S000003672, Chr X from 157270-157247,156786-156547, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps21Ap and has similarity to rat S21 ribosomal protein"
Sequence
MENDKGQLVELYVPRKCSATNRIIKADDHASVQINVAKVDEEGRAIPGEYITYALSGYVR
SRGESDDSLNRLAQNDGLLKNVWSYSR
Download sequence
Identical sequences A6ZQJ4 B3LPY2 C8ZB82 G2WGN5 N1P207 Q3E754 W7PRE9 W7RIZ1
YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C 4932.YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C YJL136C YTYst161 tr|A6ZQJ4|A6ZQJ4_YEAS7 SCRT_03539 YJL136C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]