SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL138C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL138C
Domain Number 1 Region: 91-374
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.09e-73
Family Tandem AAA-ATPase domain 3.99e-07
Further Details:      
 
Domain Number 2 Region: 58-100
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.11e-07
Family Tandem AAA-ATPase domain 0.00058
Further Details:      
 

Protein sequence

External link(s) Locus: YJL138C   Protein: S000003674
Sequence length 395
Comment TIF2 SGDID:S000003674, Chr X from 154688-153501, reverse complement, Verified ORF, "Translation initiation factor eIF4A, identical to Tif1p; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G"
Sequence
MSEGITDIEESQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGH
DVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIK
VHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGF
KEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVN
VEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERD
TIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVA
INFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN
Download sequence
Identical sequences A6ZQJ1 B3LRD4 C8ZCM2 E7KE57 E7KQ74 E7LW24 E7NK76 E7Q5E8 E7QGE4 G2WI87 H0GI72 P10081
YJL138C YKR059W YKR059W YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W YKR059W YKR059W YJL138C YKR059W 4932.YJL138C 4932.YKR059W YJL138C YKR059W SCRT_04075 YJL138C YJL138C YKR059W sp|A6ZQJ1|IF4A_YEAS7 2vso.A 2vso.B 2vsx.A 2vsx.B YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W YKR059w___KOG0327 YJL138C YKR059W YKR059W

Jump to [ Top of page · Domain architecture · Domain assignment details ]