SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL138C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL138C
Domain Number 1 Region: 91-374
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.09e-73
Family Tandem AAA-ATPase domain 0.000000399
Further Details:      
 
Domain Number 2 Region: 58-100
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000611
Family Tandem AAA-ATPase domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule cytoskeleton 1.341 26.13
microtubule associated complex 1.998 25.22
chromosomal part 1.477 20.37
cilium 1.573 16.39
nucleoplasm part 1.496 15.57
endosome 1.323 14.1
extrinsic component of plasma membrane 1.992 13.97
extracellular organelle 1.606 12.21
SWI/SNF superfamily-type complex 2.178 9.4
lateral plasma membrane 1.933 9.04

Protein sequence

External link(s) Locus: YJL138C   Protein: S000003674
Sequence length 395
Comment TIF2 SGDID:S000003674, Chr X from 154688-153501, reverse complement, Verified ORF, "Translation initiation factor eIF4A, identical to Tif1p; DEA(D/H)-box RNA helicase that couples ATPase activity to RNA binding and unwinding; forms a dumbbell structure of two compact domains connected by a linker; interacts with eIF4G"
Sequence
MSEGITDIEESQIQTNYDKVVYKFDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGH
DVLAQAQSGTGKTGTFSIAALQRIDTSVKAPQALMLAPTRELALQIQKVVMALAFHMDIK
VHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGF
KEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVN
VEEEEYKYECLTDLYDSISVTQAVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERD
TIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGRGGRFGRKGVA
INFVTNEDVGAMRELEKFYSTQIEELPSDIATLLN
Download sequence
Identical sequences A6ZQJ1 B3LRD4 C8ZCM2 E7KE57 E7KQ74 E7LW24 E7NK76 E7Q5E8 E7QGE4 G2WI87 H0GI72 N1P0I8 P10081 W7Q0Q6 W7RCW8
YKR059W SCRT_04075 YJL138C YJL138C YKR059W YJL138C YKR059W YKR059W YKR059w___KOG0327 YJL138C YKR059W 4932.YJL138C 4932.YKR059W YKR059W sp|A6ZQJ1|IF4A_YEAS7 YJL138C YKR059W YJL138C YKR059W 2vso.A 2vso.B 2vsx.A 2vsx.B YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W YJL138C YKR059W YKR059W YJL138C YKR059W YJL138C YKR059W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]