SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL140W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL140W
Domain Number 1 Region: 46-220
Classification Level Classification E-value
Superfamily HRDC-like 2.53e-50
Family RNA polymerase II subunit RBP4 (RpoF) 1.55e-08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
DNA helicase activity 1.983 45.03
ATPase activity 1.444 37.08
DNA-dependent ATPase activity 1.853 37.08
nucleotidyltransferase activity 1.652 25.59
nuclease activity 1.722 14.51
purine NTP-dependent helicase activity 2.035 6.44
magnesium ion binding 2.012 3.24
Cellular Component IC (bits) H-Score
exosome (RNase complex) 2.218 25.2
DNA-directed RNA polymerase complex 2.004 22.88
nucleoplasm part 1.419 7.11
nucleolus 1.651 5.06
chromosomal part 1.478 4.16
replication fork 2.197 4.16

Protein sequence

External link(s) Locus: YJL140W   Protein: S000003676
Sequence length 221
Comment RPB4 SGDID:S000003676, Chr X from 150958-151623, Verified ORF, "RNA polymerase II subunit B32; forms two subunit dissociable complex with Rpb7p; involved recruitment of 3'-end processing factors to transcribing RNA polymerase II complex and in export of mRNA to cytoplasm under stress conditions"
Sequence
MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIK
EALVERRRAFKRSQKKHKKKHLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETRE
KELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETVGAVIQLLKSTGLHPFEVAQL
GSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
Download sequence
Identical sequences A6ZQI9 B3LPX8 C7GPZ0 D3UF54 E7KQ72 E7QGE2 G2WGN0 H0GI70 N1P3Y0 P20433 W7PRE0 W7R0H1
YJL140W 2r7zD YJL140W YJL140W YJL140W YJL140W YJL140W YJL140W YJL140W YJL140W YJL140W YJL140W YJL140W 4932.YJL140W YJL140W YJL140W SCRT_03534 YJL140W YJL140W tr|A6ZQI9|A6ZQI9_YEAS7 YJL140W 1nt9.D 1y1v.D 1y1w.D 1y1y.D 1y77.D 2b63.D 2b8k.D 2ja5.D 2ja6.D 2ja7.D 2ja7.P 2ja8.D 2r7z.D 2r92.D 2r93.D 2vum.D 3fki.D 3h3v.E 3hou.D 3hou.P 3hov.D 3how.D 3hox.D 3hoy.D 3hoz.D 3i4m.D 3i4n.D 3j0k.D 3k1f.D 3po2.D 3po3.D 4a3b.D 4a3c.D 4a3d.D 4a3e.D 4a3f.D 4a3g.D 4a3i.D 4a3j.D 4a3k.D 4a3l.D 4a3m.D 4a93.D 4bbr.D 4bbs.D 4bxx.D 4bxz.D 4by1.D 4by7.D YJL140W YJL140W YJL140W YJL140W YJL140W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]