SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL141C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL141C
Domain Number 1 Region: 364-612,640-719
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-76
Family Protein kinases, catalytic subunit 5.42e-05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
centrosome 1.806 14.38
spindle pole 2.218 12.56
cytosol 1.307 12.38
neuron projection terminus 2.132 9.2
axon 1.511 9.2
microtubule associated complex 1.999 9.04
chromosomal part 1.477 8.96
nuclear chromosome 1.72 8.51
cell cortex 1.63 8.12
nucleoplasm part 1.418 8.04

Protein sequence

External link(s) Locus: YJL141C   Protein: S000003677
Sequence length 807
Comment YAK1 SGDID:S000003677, Chr X from 150387-147964, reverse complement, Verified ORF, "Serine-threonine protein kinase that is part of a glucose-sensing system involved in growth control in response to glucose availability; translocates from the cytoplasm to the nucleus and phosphorylates Pop2p in response to a glucose signal"
Sequence
MNSSNNNDSSSSNSNMNNSLSPTLVTHSDASMGSGRASPDNSHMGRGIWNPSYVNQGSQR
SPQQQHQNHHQQQQQQQQQQQQNSQFCFVNPWNEEKVTNSQQNLVYPPQYDDLNSNESLD
AYRRRKSSLVVPPARAPAPNPFQYDSYPAYTSSNTSLAGNSSGQYPSGYQQQQQQVYQQG
AIHPSQFGSRFVPSLYDRQDFQRRQSLAATNYSSNFSSLNSNTNQGTNSIPVMSPYRRLS
AYPPSTSPPLQPPFKQLRRDEVQGQKLSIPQMQLCNSKNDLQPVLNATPKFRRASLNSKT
ISPLVSVTKSLITTYSLCSPEFTYQTSKNPKRVLTKPSEGKCNNGFDNINSDYILYVNDV
LGVEQNRKYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELL
NQKIDPTNKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQI
LDSLCVLKESKLIHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPE
IILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNS
GKFMKKLAPEESSSSTQKHRMKTIEEFCREYNIVEKPSKQYFKWRKLPDIIRNYRYPKSI
QNSQELIDQEMQNRECLIHFLGGVLNLNPLERWTPQQAMLHPFITKQEFTGEWFPPGSSL
PGPSEKHDDAKGQQSEYGSANDSSNNAGHNYVYNPSSATGGADSVDIGAISKRKENTSGD
ISNNFAVTHSVQEGPTSAFNKLHIVEE
Download sequence
Identical sequences P14680
YJL141C YJL141C 4932.YJL141C YJL141C YJL141C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]