SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL141C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL141C
Domain Number 1 Region: 364-612,640-719
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-76
Family Protein kinases, catalytic subunit 0.0000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex, transferring phosphorus-containing groups 1.653 20.41
centrosome 1.852 15.05
spindle 1.756 12.66
integral component of plasma membrane 1.37 12.19
plasma membrane receptor complex 1.761 12.19
microtubule associated complex 2.062 9.54
chromosomal part 1.471 8.57
cytoplasmic region 1.533 8.36
cell division site 2.089 8.19
midbody 2.148 8
Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.668 85.69
growth factor binding 1.647 44.44
ATP binding 1.507 39.95
lyase activity 1.42 25
cytokine binding 2.018 23.74
calmodulin binding 2.043 19.32
magnesium ion binding 1.858 16.86
structure-specific DNA binding 2.206 15.3
protein domain specific binding 1.437 12.42
enzyme activator activity 1.476 10.49

Protein sequence

External link(s) Locus: YJL141C   Protein: S000003677
Sequence length 807
Comment YAK1 SGDID:S000003677, Chr X from 150387-147964, reverse complement, Verified ORF, "Serine-threonine protein kinase that is part of a glucose-sensing system involved in growth control in response to glucose availability; translocates from the cytoplasm to the nucleus and phosphorylates Pop2p in response to a glucose signal"
Sequence
MNSSNNNDSSSSNSNMNNSLSPTLVTHSDASMGSGRASPDNSHMGRGIWNPSYVNQGSQR
SPQQQHQNHHQQQQQQQQQQQQNSQFCFVNPWNEEKVTNSQQNLVYPPQYDDLNSNESLD
AYRRRKSSLVVPPARAPAPNPFQYDSYPAYTSSNTSLAGNSSGQYPSGYQQQQQQVYQQG
AIHPSQFGSRFVPSLYDRQDFQRRQSLAATNYSSNFSSLNSNTNQGTNSIPVMSPYRRLS
AYPPSTSPPLQPPFKQLRRDEVQGQKLSIPQMQLCNSKNDLQPVLNATPKFRRASLNSKT
ISPLVSVTKSLITTYSLCSPEFTYQTSKNPKRVLTKPSEGKCNNGFDNINSDYILYVNDV
LGVEQNRKYLVLDILGQGTFGQVVKCQNLLTKEILAVKVVKSRTEYLTQSITEAKILELL
NQKIDPTNKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQI
LDSLCVLKESKLIHCDLKPENILLCAPDKPELKIIDFGSSCEEARTVYTYIQSRFYRAPE
IILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNS
GKFMKKLAPEESSSSTQKHRMKTIEEFCREYNIVEKPSKQYFKWRKLPDIIRNYRYPKSI
QNSQELIDQEMQNRECLIHFLGGVLNLNPLERWTPQQAMLHPFITKQEFTGEWFPPGSSL
PGPSEKHDDAKGQQSEYGSANDSSNNAGHNYVYNPSSATGGADSVDIGAISKRKENTSGD
ISNNFAVTHSVQEGPTSAFNKLHIVEE
Download sequence
Identical sequences P14680
YJL141C YJL141C 4932.YJL141C YJL141C YJL141C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]