SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL153C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL153C
Domain Number 1 Region: 10-322,437-532
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.11e-167
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.000000000000401
Further Details:      
 
Domain Number 2 Region: 323-437
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.46e-40
Family Dihydrodipicolinate reductase-like 0.000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL153C   Protein: S000003689
Sequence length 533
Comment INO1 SGDID:S000003689, Chr X from 135930-134329, reverse complement, Verified ORF, "Inositol 1-phosphate synthase, involved in synthesis of inositol phosphates and inositol-containing phospholipids; transcription is coregulated with other phospholipid biosynthetic genes by Ino2p and Ino4p, which bind the UASINO DNA element"
Sequence
MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDL
KKPEKLGIMLIGLGGNNGSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGID
AEGNDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVK
PLPSIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVI
VLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT
FVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL
SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS
ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPV
LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL
Download sequence
Identical sequences A0A0L8VMV0 B3LPW8 H0GI60 N1P1Z0 P11986
NP_012382.2.97178 YJL153C YJL153C 4932.YJL153C YJL153C YJL153C SCRT_03524 1p1jA YJL153C 1jkf_A 1jkf_B 1jki_A 1jki_B 1la2_A 1la2_B 1la2_C 1la2_D 1p1f_A 1p1f_B 1p1h_A 1p1h_B 1p1h_C 1p1h_D 1p1i_A 1p1i_B 1p1j_A 1p1j_B 1p1k_A 1p1k_B 1rm0_A 1rm0_B YJL153C YJL153C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]