SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL162C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL162C
Domain Number 1 Region: 7-77
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-18
Family Chaperone J-domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YJL162C   Protein: S000003698
Sequence length 583
Comment JJJ2 SGDID:S000003698, Chr X from 115625-113874, reverse complement, Verified ORF, "Protein of unknown function, contains a J-domain, which is a region with homology to the E. coli DnaJ protein"
Sequence
MSQVIEPQLDRTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHA
HSILTDEDQKLRYDRDLKIKGLHTYQPKKNCHIFKTKAKESQGASPTLGQSEAYHRQNKP
YEQQPYGFGVGKKMTSSSKSKVPIFKSFNLKSYQRNHYYSSKKERKHGSPDIDSLFHETN
GASKVRMTDAGKMDTNSQFQEIWEILGKNAYTHKSYSEDPNSCLGSALSDHEEEEEAGKQ
QQQQQQQQQQQQHYGMTSKSSSPDEEKKNNKEPKRESRVSPEENGEEETGHKQFKLPKTS
TFSSGSHDSNLQSPFYNHEYRHYARSKFECKNQFRKSVSPIKEIPATTSANEGWNILRDI
IEKLNISNVDDRNKDLLFRRDEIGDKNHSDSIDIENLSIKEPKGMKRRKKDDISLEELFQ
SLPREKDYFMMDAINDSLESINLFKKPKTTQSHEQGGTFAQAESNRAKFKPLLEQCGITP
EILDLEIPEIPEFDAVADLETLKLNVQLFNNQCNKLKETIHQVSLQRLRADTQFSDMLTQ
KQSIMVWKTYLEFDKSLMDKLNILQERQMQVIKIFSERCDGKV
Download sequence
Identical sequences C7GRZ0 P46997
YJL162C YJL162C 4932.YJL162C YJL162C YJL162C YJL162C YJL162C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]