SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL162C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL162C
Domain Number 1 Region: 7-77
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-18
Family Chaperone J-domain 0.00085
Further Details:      
 

Protein sequence

External link(s) Locus: YJL162C   Protein: S000003698
Sequence length 583
Comment JJJ2 SGDID:S000003698, Chr X from 115625-113874, reverse complement, Verified ORF, "Protein of unknown function, contains a J-domain, which is a region with homology to the E. coli DnaJ protein"
Sequence
MSQVIEPQLDRTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHA
HSILTDEDQKLRYDRDLKIKGLHTYQPKKNCHIFKTKAKESQGASPTLGQSEAYHRQNKP
YEQQPYGFGVGKKMTSSSKSKVPIFKSFNLKSYQRNHYYSSKKERKHGSPDIDSLFHETN
GASKVRMTDAGKMDTNSQFQEIWEILGKNAYTHKSYSEDPNSCLGSALSDHEEEEEAGKQ
QQQQQQQQQQQQHYGMTSKSSSPDEEKKNNKEPKRESRVSPEENGEEETGHKQFKLPKTS
TFSSGSHDSNLQSPFYNHEYRHYARSKFECKNQFRKSVSPIKEIPATTSANEGWNILRDI
IEKLNISNVDDRNKDLLFRRDEIGDKNHSDSIDIENLSIKEPKGMKRRKKDDISLEELFQ
SLPREKDYFMMDAINDSLESINLFKKPKTTQSHEQGGTFAQAESNRAKFKPLLEQCGITP
EILDLEIPEIPEFDAVADLETLKLNVQLFNNQCNKLKETIHQVSLQRLRADTQFSDMLTQ
KQSIMVWKTYLEFDKSLMDKLNILQERQMQVIKIFSERCDGKV
Download sequence
Identical sequences C7GRZ0 P46997
YJL162C YJL162C 4932.YJL162C YJL162C YJL162C YJL162C YJL162C

Jump to [ Top of page · Domain architecture · Domain assignment details ]