SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL164C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL164C
Domain Number 1 Region: 60-366
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-100
Family Protein kinases, catalytic subunit 0.0000000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.662 87.19
growth factor binding 1.592 45.46
ATP binding 1.433 38.77
lyase activity 1.408 25.05
cytokine binding 1.952 24.28
calmodulin binding 2.02 18.7
magnesium ion binding 1.87 15.88
double-stranded DNA binding 1.546 15.2
protein domain specific binding 1.452 12.79
enzyme activator activity 1.431 10.25
Cellular Component IC (bits) H-Score
plasma membrane receptor complex 1.824 13.31
spindle 1.815 12.85
cytosol 1.295 12.48
chromosomal part 1.512 9.33
synapse part 1.419 8.28
midbody 2.182 8.19
cell division site 2.125 8.13
nuclear chromosome part 1.842 8.05
site of polarized growth 1.648 7.71
cytoplasmic region 1.567 7.39

Protein sequence

External link(s) Locus: YJL164C   Protein: S000003700
Sequence length 397
Comment TPK1 SGDID:S000003700, Chr X from 111153-109960, reverse complement, Verified ORF, "cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; partially redundant with Tpk2p and Tpk3p"
Sequence
MSTEEQNGGGQKSLDDRQGEESQKGETSERETTATESGNESKSVEKEGGETQEKPKQPHV
TYYNEEQYKQFIAQARVTVGSIVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKK
EIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQ
RFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY
TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELR
FPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEP
PIQQGQGDTSQFDKYPEEDINYGVQGEDPYADLFRDF
Download sequence
Identical sequences 4932.YJL164C YJL164C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]