SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL164C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL164C
Domain Number 1 Region: 60-366
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-100
Family Protein kinases, catalytic subunit 0.0000000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.668 85.69
growth factor binding 1.647 44.44
ATP binding 1.507 39.95
lyase activity 1.42 25
cytokine binding 2.018 23.74
calmodulin binding 2.043 19.32
magnesium ion binding 1.858 16.86
structure-specific DNA binding 2.206 15.3
protein domain specific binding 1.437 12.42
enzyme activator activity 1.476 10.49
Cellular Component IC (bits) H-Score
transferase complex, transferring phosphorus-containing groups 1.653 20.41
centrosome 1.852 15.05
spindle 1.756 12.66
integral component of plasma membrane 1.37 12.19
plasma membrane receptor complex 1.761 12.19
microtubule associated complex 2.062 9.54
chromosomal part 1.471 8.57
cytoplasmic region 1.533 8.36
cell division site 2.089 8.19
midbody 2.148 8

Protein sequence

External link(s) Locus: YJL164C   Protein: S000003700
Sequence length 397
Comment TPK1 SGDID:S000003700, Chr X from 111153-109960, reverse complement, Verified ORF, "cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; partially redundant with Tpk2p and Tpk3p"
Sequence
MSTEEQNGGGQKSLDDRQGEESQKGETSERETTATESGNESKSVEKEGGETQEKPKQPHV
TYYNEEQYKQFIAQARVTVGSIVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKK
EIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQ
RFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY
TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELR
FPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEP
PIQQGQGDTSQFDKYPEEDINYGVQGEDPYADLFRDF
Download sequence
Identical sequences YJL164C 4932.YJL164C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]