SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL164C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL164C
Domain Number 1 Region: 60-366
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-100
Family Protein kinases, catalytic subunit 6.37e-11
Further Details:      
 

Protein sequence

External link(s) Locus: YJL164C   Protein: S000003700
Sequence length 397
Comment TPK1 SGDID:S000003700, Chr X from 111153-109960, reverse complement, Verified ORF, "cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; partially redundant with Tpk2p and Tpk3p"
Sequence
MSTEEQNGGGQKSLDDRQGEESQKGETSERETTATESGNESKSVEKEGGETQEKPKQPHV
TYYNEEQYKQFIAQARVTVGSIVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKK
EIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQ
RFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY
TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELR
FPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEP
PIQQGQGDTSQFDKYPEEDINYGVQGEDPYADLFRDF
Download sequence
Identical sequences YJL164C 4932.YJL164C

Jump to [ Top of page · Domain architecture · Domain assignment details ]