SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL164C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL164C
Domain Number 1 Region: 60-366
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.88e-100
Family Protein kinases, catalytic subunit 6.37e-11
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
centrosome 1.805 14.58
spindle pole 2.218 12.59
cytosol 1.305 12.35
axon 1.502 9.91
neuron projection terminus 2.106 9.91
chromosomal part 1.478 9.28
microtubule associated complex 1.998 9.06
nuclear chromosome 1.723 8.53
cell cortex 1.621 8.28
nucleoplasm part 1.419 8.05

Protein sequence

External link(s) Locus: YJL164C   Protein: S000003700
Sequence length 397
Comment TPK1 SGDID:S000003700, Chr X from 111153-109960, reverse complement, Verified ORF, "cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; partially redundant with Tpk2p and Tpk3p"
Sequence
MSTEEQNGGGQKSLDDRQGEESQKGETSERETTATESGNESKSVEKEGGETQEKPKQPHV
TYYNEEQYKQFIAQARVTVGSIVYKNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKK
EIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQ
RFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY
TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELR
FPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKEVVWEKLLSRNIETPYEP
PIQQGQGDTSQFDKYPEEDINYGVQGEDPYADLFRDF
Download sequence
Identical sequences YJL164C 4932.YJL164C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]