SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL167W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL167W
Domain Number 1 Region: 9-351
Classification Level Classification E-value
Superfamily Terpenoid synthases 3.91e-89
Family Isoprenyl diphosphate synthases 4.19e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YJL167W   Protein: S000003703
Sequence length 352
Comment ERG20 SGDID:S000003703, Chr X from 105008-106066, Verified ORF, "Farnesyl pyrophosphate synthetase, has both dimethylallyltranstransferase and geranyltranstransferase activities; catalyzes the formation of C15 farnesyl pyrophosphate units for isoprenoid and sterol biosynthesis"
Sequence
MASEKEIRRERFLNVFPKLVEELNASLLAYGMPKEACDWYAHSLNYNTPGGKLNRGLSVV
DTYAILSNKTVEQLGQEEYEKVAILGWCIELLQAYFLVADDMMDKSITRRGQPCWYKVPE
VGEIAINDAFMLEAAIYKLLKSHFRNEKYYIDITELFHEVTFQTELGQLMDLITAPEDKV
DLSKFSLKKHSFIVTFKTAYYSFYLPVALAMYVAGITDEKDLKQARDVLIPLGEYFQIQD
DYLDCFGTPEQIGKIGTDIQDNKCSWVINKALELASAEQRKTLDENYGKKDSVAEAKCKK
IFNDLKIEQLYHEYEESIAKDLKAKISQVDESRGFKADVLTAFLNKVYKRSK
Download sequence
Identical sequences B3LPV6 B5VL19 C7GRZ5 C8ZB52 E7KE36 E7KQ50 E7LW73 P08524
YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W 4932.YJL167W YJL167W SCRT_03510 YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W YJL167W

Jump to [ Top of page · Domain architecture · Domain assignment details ]