SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL169W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL169W   Protein: S000003705
Sequence length 122
Comment YJL169W SGDID:S000003705, Chr X from 102093-102461, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene YJL168C/SET2"
Sequence
MYKEINGKDKKNYLLQIAITIKVQDFLWDRKRETSPKYACLVNYDDVEGGGEDILVDADD
NPNAFFCFFLRIILSMYEFMNSLTLCLFPLVKSSGGALEESFLSSFVVRIFTMSLAHCLM
FS
Download sequence
Identical sequences P46994
4932.YJL169W YTYst410 YJL169W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]