SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL169W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJL169W   Protein: S000003705
Sequence length 122
Comment YJL169W SGDID:S000003705, Chr X from 102093-102461, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified gene YJL168C/SET2"
Sequence
MYKEINGKDKKNYLLQIAITIKVQDFLWDRKRETSPKYACLVNYDDVEGGGEDILVDADD
NPNAFFCFFLRIILSMYEFMNSLTLCLFPLVKSSGGALEESFLSSFVVRIFTMSLAHCLM
FS
Download sequence
Identical sequences P46994
YJL169W 4932.YJL169W YTYst410

Jump to [ Top of page · Domain architecture · Domain assignment details ]