SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL180C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL180C
Domain Number 1 Region: 27-320
Classification Level Classification E-value
Superfamily ATP12-like 1.19e-59
Family ATP12-like 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL180C   Protein: S000003716
Sequence length 325
Comment ATP12 SGDID:S000003716, Chr X from 88558-87581, reverse complement, Verified ORF, "Conserved protein required for assembly of alpha and beta subunits into the F1 sector of mitochondrial F1F0 ATP synthase; mutation of human ATP12 reduces active ATP synthase levels and is associated with the disorder ATPAF2 deficiency"
Sequence
MLPSLRKGCFIVNSIRLKLPRFYSLNAQPLGTDNTIENNTPTETNRLSKTSQKFWEKVSL
NRDVEKGKIALQLDGRTIKTPLGNGIIVDNAKSLLAYLLKLEWSSLSSLSIKTHSLPLTS
LVARCIDLQMTNEPGCDPQLVAKIGGNSDVIKNQLLRYLDTDTLLVFSPMNEFEGRLRNA
QNELYIPIIKGMEEFLRNFSSESNIRLQILDADIHGLRGNQQSDIVKNAAKKYMSSLSPW
DLAILEKTVLTTKSFICGVLLLENKKDTANLIPALKTDMDNIVRAATLETIFQVEKWGEV
EDTHDVDKRDIRRKIHTAAIAAFKQ
Download sequence
Identical sequences P22135
YJL180C YJL180C YJL180C YJL180C YJL180C 355414 YR26 YJL180C 4932.YJL180C YJL180C YJL180C YJL180C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]