SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJL187C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL187C
Domain Number 1 Region: 436-662,741-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.79e-58
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
transferase complex, transferring phosphorus-containing groups 1.653 20.41
centrosome 1.852 15.05
spindle 1.756 12.66
integral component of plasma membrane 1.37 12.19
plasma membrane receptor complex 1.761 12.19
microtubule associated complex 2.062 9.54
chromosomal part 1.471 8.57
cytoplasmic region 1.533 8.36
cell division site 2.089 8.19
midbody 2.148 8
Molecular Function IC (bits) H-Score
transmembrane receptor protein kinase activity 1.668 85.69
growth factor binding 1.647 44.44
ATP binding 1.507 39.95
lyase activity 1.42 25
cytokine binding 2.018 23.74
calmodulin binding 2.043 19.32
magnesium ion binding 1.858 16.86
structure-specific DNA binding 2.206 15.3
protein domain specific binding 1.437 12.42
enzyme activator activity 1.476 10.49

Protein sequence

External link(s) Locus: YJL187C   Protein: S000003723
Sequence length 819
Comment SWE1 SGDID:S000003723, Chr X from 79261-76802, reverse complement, Verified ORF, "Protein kinase that regulates the G2/M transition by inhibition of Cdc28p kinase activity; localizes to the nucleus and to the daughter side of the mother-bud neck; homolog of S. pombe Wee1p; potential Cdc28p substrate"
Sequence
MSSLDEDEEDFEMLDTENLQFMGKKMFGKQAGEDESDDFAIGGSTPTNKLKFYPYSNNKL
TRSTGTLNLSLSNTALSEANSKFLGKIEEEEEEEEEGKDEESVDSRIKRWSPFHENESVT
TPITKRSAEKTNSPISLKQWNQRWFPKNDARTENTSSSSSYSVAKPNQSAFTSSGLVSKM
SMDTSLYPAKLRIPETPVKKSPLVEGRDHKHVHLSSSKNASSSLSVSPLNFVEDNNLQED
LLFSDSPSSKALPSIHVPTIDSSPLSEAKYHAHDRHNNQTNILSPTNSLVTNSSPQTLHS
NKFKKIKRARNSVILKNRELTNSLQQFKDDLYGTDENFPPPIIISSHHSTRKNPQPYQFR
GRYDNDTDEEISTPTRRKSIIGATSQTHRESRPLSLSSAIVTNTTSAETHSISSTDSSPL
NSKRRLISSNKLSANPDSHLFEKFTNVHSIGKGQFSTVYQVTFAQTNKKYAIKAIKPNKY
NSLKRILLEIKILNEVTNQITMDQEGKEYIIDYISSWKFQNSYYIMTELCENGNLDGFLQ
EQVIAKKKRLEDWRIWKIIVELSLALRFIHDSCHIVHLDLKPANVMITFEGNLKLGDFGM
ATHLPLEDKSFENEGDREYIAPEIISDCTYDYKADIFSLGLMIVEIAANVVLPDNGNAWH
KLRSGDLSDAGRLSSTDIHSESLFSDITKVDTNDLFDFERDNISGNSNNAGTSTVHNNSN
INNPNMNNGNDNNNVNTAATKNRLILHKSSKIPAWVPKFLIDGESLERIVRWMIEPNYER
RPTANQILQTEECLYVEMTRNAGAIIQEDDFGPKPKFFI
Download sequence
Identical sequences P32944
YJL187C YJL187C 4932.YJL187C YJL187C YJL187C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]