SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL187C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL187C
Domain Number 1 Region: 436-662,741-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.79e-58
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 

Protein sequence

External link(s) Locus: YJL187C   Protein: S000003723
Sequence length 819
Comment SWE1 SGDID:S000003723, Chr X from 79261-76802, reverse complement, Verified ORF, "Protein kinase that regulates the G2/M transition by inhibition of Cdc28p kinase activity; localizes to the nucleus and to the daughter side of the mother-bud neck; homolog of S. pombe Wee1p; potential Cdc28p substrate"
Sequence
MSSLDEDEEDFEMLDTENLQFMGKKMFGKQAGEDESDDFAIGGSTPTNKLKFYPYSNNKL
TRSTGTLNLSLSNTALSEANSKFLGKIEEEEEEEEEGKDEESVDSRIKRWSPFHENESVT
TPITKRSAEKTNSPISLKQWNQRWFPKNDARTENTSSSSSYSVAKPNQSAFTSSGLVSKM
SMDTSLYPAKLRIPETPVKKSPLVEGRDHKHVHLSSSKNASSSLSVSPLNFVEDNNLQED
LLFSDSPSSKALPSIHVPTIDSSPLSEAKYHAHDRHNNQTNILSPTNSLVTNSSPQTLHS
NKFKKIKRARNSVILKNRELTNSLQQFKDDLYGTDENFPPPIIISSHHSTRKNPQPYQFR
GRYDNDTDEEISTPTRRKSIIGATSQTHRESRPLSLSSAIVTNTTSAETHSISSTDSSPL
NSKRRLISSNKLSANPDSHLFEKFTNVHSIGKGQFSTVYQVTFAQTNKKYAIKAIKPNKY
NSLKRILLEIKILNEVTNQITMDQEGKEYIIDYISSWKFQNSYYIMTELCENGNLDGFLQ
EQVIAKKKRLEDWRIWKIIVELSLALRFIHDSCHIVHLDLKPANVMITFEGNLKLGDFGM
ATHLPLEDKSFENEGDREYIAPEIISDCTYDYKADIFSLGLMIVEIAANVVLPDNGNAWH
KLRSGDLSDAGRLSSTDIHSESLFSDITKVDTNDLFDFERDNISGNSNNAGTSTVHNNSN
INNPNMNNGNDNNNVNTAATKNRLILHKSSKIPAWVPKFLIDGESLERIVRWMIEPNYER
RPTANQILQTEECLYVEMTRNAGAIIQEDDFGPKPKFFI
Download sequence
Identical sequences P32944
YJL187C YJL187C 4932.YJL187C YJL187C YJL187C

Jump to [ Top of page · Domain architecture · Domain assignment details ]