SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL187C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL187C
Domain Number 1 Region: 436-662,741-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.79e-58
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
spindle 1.789 20.41
centrosome 1.793 14.51
cytosol 1.301 13.09
synapse part 1.451 11.52
axon 1.505 9.91
neuron projection terminus 2.132 9.91
chromosomal part 1.477 9.63
microtubule associated complex 1.998 9.07
transferase complex 1.423 8.89
nuclear chromosome 1.73 8.54

Protein sequence

External link(s) Locus: YJL187C   Protein: S000003723
Sequence length 819
Comment SWE1 SGDID:S000003723, Chr X from 79261-76802, reverse complement, Verified ORF, "Protein kinase that regulates the G2/M transition by inhibition of Cdc28p kinase activity; localizes to the nucleus and to the daughter side of the mother-bud neck; homolog of S. pombe Wee1p; potential Cdc28p substrate"
Sequence
MSSLDEDEEDFEMLDTENLQFMGKKMFGKQAGEDESDDFAIGGSTPTNKLKFYPYSNNKL
TRSTGTLNLSLSNTALSEANSKFLGKIEEEEEEEEEGKDEESVDSRIKRWSPFHENESVT
TPITKRSAEKTNSPISLKQWNQRWFPKNDARTENTSSSSSYSVAKPNQSAFTSSGLVSKM
SMDTSLYPAKLRIPETPVKKSPLVEGRDHKHVHLSSSKNASSSLSVSPLNFVEDNNLQED
LLFSDSPSSKALPSIHVPTIDSSPLSEAKYHAHDRHNNQTNILSPTNSLVTNSSPQTLHS
NKFKKIKRARNSVILKNRELTNSLQQFKDDLYGTDENFPPPIIISSHHSTRKNPQPYQFR
GRYDNDTDEEISTPTRRKSIIGATSQTHRESRPLSLSSAIVTNTTSAETHSISSTDSSPL
NSKRRLISSNKLSANPDSHLFEKFTNVHSIGKGQFSTVYQVTFAQTNKKYAIKAIKPNKY
NSLKRILLEIKILNEVTNQITMDQEGKEYIIDYISSWKFQNSYYIMTELCENGNLDGFLQ
EQVIAKKKRLEDWRIWKIIVELSLALRFIHDSCHIVHLDLKPANVMITFEGNLKLGDFGM
ATHLPLEDKSFENEGDREYIAPEIISDCTYDYKADIFSLGLMIVEIAANVVLPDNGNAWH
KLRSGDLSDAGRLSSTDIHSESLFSDITKVDTNDLFDFERDNISGNSNNAGTSTVHNNSN
INNPNMNNGNDNNNVNTAATKNRLILHKSSKIPAWVPKFLIDGESLERIVRWMIEPNYER
RPTANQILQTEECLYVEMTRNAGAIIQEDDFGPKPKFFI
Download sequence
Identical sequences P32944
YJL187C 4932.YJL187C YJL187C YJL187C YJL187C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]