SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL188C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJL188C   Protein: S000003724
Sequence length 102
Comment BUD19 SGDID:S000003724, Chr X from 76509-76201, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; 88% of ORF overlaps the verified gene RPL39; diploid mutant displays a weak budding pattern phenotype in a systematic assay"
Sequence
MTKSLKHKYVLRLDVHLGSSPVSSLSVVTDSVVGSQSDPLWQWSVLLLSLSHFLLDSERL
LSLIKRETYRAHTKCTIVKNVSNNVQTHQYDAFTDPRQYHLT
Download sequence
Identical sequences O94143
YJL188C 4932.YJL188C

Jump to [ Top of page · Domain architecture · Domain assignment details ]