SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YJL188C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL188C   Protein: S000003724
Sequence length 102
Comment BUD19 SGDID:S000003724, Chr X from 76509-76201, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; 88% of ORF overlaps the verified gene RPL39; diploid mutant displays a weak budding pattern phenotype in a systematic assay"
Sequence
MTKSLKHKYVLRLDVHLGSSPVSSLSVVTDSVVGSQSDPLWQWSVLLLSLSHFLLDSERL
LSLIKRETYRAHTKCTIVKNVSNNVQTHQYDAFTDPRQYHLT
Download sequence
Identical sequences O94143
4932.YJL188C YJL188C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]