SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL197C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJL197C-A   Protein: S000028839
Sequence length 93
Comment YJL197C-A SGDID:S000028839, Chr X from 66085-65804, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the verified gene YJL197C/UBP12"
Sequence
MEKKDLSLSVTLIDVYCSISLYCSNSTSGYFSTNNGKASAKSVRFPTGSGNGIYPPLKWT
NLFCNFILIAPGLFNSSSFNVIKKGTPNNIAFL
Download sequence
Identical sequences C8ZB24 P0C5P0
YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A 4932.YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]