SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL197C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL197C-A   Protein: S000028839
Sequence length 93
Comment YJL197C-A SGDID:S000028839, Chr X from 66085-65804, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; completely overlaps the verified gene YJL197C/UBP12"
Sequence
MEKKDLSLSVTLIDVYCSISLYCSNSTSGYFSTNNGKASAKSVRFPTGSGNGIYPPLKWT
NLFCNFILIAPGLFNSSSFNVIKKGTPNNIAFL
Download sequence
Identical sequences C8ZB24 P0C5P0
YJL197C-A YJL197C-A YJL197C-A 4932.YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A YJL197C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]