SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL210W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YJL210W
Domain Number - Region: 193-265
Classification Level Classification E-value
Superfamily FdhE-like 0.00222
Family FdhE-like 0.0078
Further Details:      
 

Protein sequence

External link(s) Locus: YJL210W   Protein: S000003746
Sequence length 271
Comment PEX2 SGDID:S000003746, Chr X from 36919-37734, Verified ORF, "RING-finger peroxin, peroxisomal membrane protein with a C-terminal zinc-binding RING domain, forms translocation subcomplex with Pex10p and Pex12p which functions in peroxisomal matrix protein import"
Sequence
MSRVAQLDSIALDKELYGQFWSEFNAAFNTSEHKEEWELALNTVVFMCATRFLPHYGSSC
TYGSALSGVVFQCRKRTLYVVTVLAGYVWKKITHIIFNGPHCGNQMMWLKLYKWVNLLYH
GCDVTNFLRFLAAEGPNARAFLSPLYRAFNVHSTRLIRDGSAIASEFYSNSVFAGLEYQN
RQLLWNALLELFSNTLLTKRGLLTFVKKPPRSRSTTTYKTVCPRCGGFPTNPYQIACCRA
NYCYVCVVKALEWSMCDACGSSGRLTASPVY
Download sequence
Identical sequences A6ZQC9 N1P1K5 P32800
YJL210W 4932.YJL210W YJL210W YJL210W tr|A6ZQC9|A6ZQC9_YEAS7 YJL210W YJL210W YT298

Jump to [ Top of page · Domain architecture · Domain assignment details ]