SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL210W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YJL210W
Domain Number - Region: 193-265
Classification Level Classification E-value
Superfamily FdhE-like 0.00222
Family FdhE-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YJL210W   Protein: S000003746
Sequence length 271
Comment PEX2 SGDID:S000003746, Chr X from 36919-37734, Verified ORF, "RING-finger peroxin, peroxisomal membrane protein with a C-terminal zinc-binding RING domain, forms translocation subcomplex with Pex10p and Pex12p which functions in peroxisomal matrix protein import"
Sequence
MSRVAQLDSIALDKELYGQFWSEFNAAFNTSEHKEEWELALNTVVFMCATRFLPHYGSSC
TYGSALSGVVFQCRKRTLYVVTVLAGYVWKKITHIIFNGPHCGNQMMWLKLYKWVNLLYH
GCDVTNFLRFLAAEGPNARAFLSPLYRAFNVHSTRLIRDGSAIASEFYSNSVFAGLEYQN
RQLLWNALLELFSNTLLTKRGLLTFVKKPPRSRSTTTYKTVCPRCGGFPTNPYQIACCRA
NYCYVCVVKALEWSMCDACGSSGRLTASPVY
Download sequence
Identical sequences A6ZQC9 N1P1K5 P32800
YJL210W YT298 YJL210W 4932.YJL210W YJL210W tr|A6ZQC9|A6ZQC9_YEAS7 YJL210W YJL210W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]