SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL221C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL221C
Domain Number 1 Region: 11-507
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.86e-130
Family Amylase, catalytic domain 3.06e-09
Further Details:      
 
Domain Number 2 Region: 514-587
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.92e-14
Family alpha-Amylases, C-terminal beta-sheet domain 0.0082
Further Details:      
 

Protein sequence

External link(s) Locus: YJL221C   Protein: S000003757
Sequence length 589
Comment FSP2 SGDID:S000003757, Chr X from 18536-16767, reverse complement, Verified ORF, "Protein of unknown function, expression is induced during nitrogen limitation"
Sequence
MTISSAHPETEPKWWKEATIYQIYPASFKDSNNDGWGDMKGIASKLEYIKELGTDAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWRSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVAGLPDAPVIDENSKWQL
SDPFTMNGPRIHEFHQEMNKFIRNRVKDGREIMTVGEMRHATDETKRLYTSASRHELSEL
FNFSHTDVGTSPKFRQNLIPYELKDWKVALAELFRYVNGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLVSLSGTLYVYQGQELGEINFKNWPIEKYEDVEVRNNYDAIK
EEHGENSKEMKRFLEAIALISRDHARTPMQWSREEPNAGFSGPNAKPWFYLNESFREGIN
AEDESKDPNSVLNFWKEALRFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYDNKTLFAA
LNFSSDSIDFTIPNNSSSFKLEFGNYPRSEVDASSRTLKPWEGRIYISE
Download sequence
Identical sequences E1AFY9 P0CW40 P0CW41
YIL172C YJL221C 4932.YIL172C 4932.YJL221C YIL172C YJL221C YIL172C YJL221C

Jump to [ Top of page · Domain architecture · Domain assignment details ]