SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJL221C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL221C
Domain Number 1 Region: 11-507
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.86e-130
Family Amylase, catalytic domain 0.00000000306
Further Details:      
 
Domain Number 2 Region: 514-587
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000000192
Family alpha-Amylases, C-terminal beta-sheet domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
external encapsulating structure 1.632 21.57
endoplasmic reticulum part 1.431 19.08
microvillus 1.891 10.41
side of membrane 1.701 7.49
external side of plasma membrane 1.827 7.49
extracellular space 1.521 5.74
cell-cell junction 1.378 5.52
extracellular vesicular exosome 1.849 4.8
symplast 2.053 4.8
extracellular organelle 1.606 4.7

Protein sequence

External link(s) Locus: YJL221C   Protein: S000003757
Sequence length 589
Comment FSP2 SGDID:S000003757, Chr X from 18536-16767, reverse complement, Verified ORF, "Protein of unknown function, expression is induced during nitrogen limitation"
Sequence
MTISSAHPETEPKWWKEATIYQIYPASFKDSNNDGWGDMKGIASKLEYIKELGTDAIWIS
PFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWF
KESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWRSYFGGSAWTFDEKTQEFYLRLFCS
TQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVAGLPDAPVIDENSKWQL
SDPFTMNGPRIHEFHQEMNKFIRNRVKDGREIMTVGEMRHATDETKRLYTSASRHELSEL
FNFSHTDVGTSPKFRQNLIPYELKDWKVALAELFRYVNGTDCWSTIYLENHDQPRSITRF
GDDSPKNRVISGKLLSVLLVSLSGTLYVYQGQELGEINFKNWPIEKYEDVEVRNNYDAIK
EEHGENSKEMKRFLEAIALISRDHARTPMQWSREEPNAGFSGPNAKPWFYLNESFREGIN
AEDESKDPNSVLNFWKEALRFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYDNKTLFAA
LNFSSDSIDFTIPNNSSSFKLEFGNYPRSEVDASSRTLKPWEGRIYISE
Download sequence
Identical sequences E1AFY9 P0CW40 P0CW41
YIL172C YJL221C 4932.YIL172C 4932.YJL221C YIL172C YJL221C YIL172C YJL221C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]