SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR001W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJR001W   Protein: S000003761
Sequence length 602
Comment AVT1 SGDID:S000003761, Chr X from 436796-438604, Verified ORF, "Vacuolar transporter, imports large neutral amino acids into the vacuole; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters"
Sequence
MPEQEPLSPNGRKRSEVHYISIPLNRGSAFSPDDSVSQFQSDGFMTRRQSILDHPVGSFK
GVNSLSRFATSLRRANSFRNIELNADNERSFFKESNDETYDPDTLAPALDGRRLSVTLNN
AGRPRITNLANNDRVSTASMAIHDDDYGSIQNSTIGDSGSILRPTASLTEMMSGGAGRRF
TNNDMDSIVVKRVEGVDGKVVTLLAGQSTAPQTIFNSINVLIGIGLLALPLGLKYAGWVI
GLTMLAIFALATFCTAELLSRCLDTDPTLISYADLGYAAFGTKGRALISALFTLDLLGSG
VSLVILFGDSLNALFPQYSTTFFKIVSFFIVTPPVFIPLSVLSNISLLGILSTTGTVLVI
CCCGLYKSSSPGSLVNPMETSMWPIDLKHLCLSIGLLSACWGGHAVFPNLKTDMRHPDKF
KDCLKTTYKITSVTDIGTAVIGFLMFGNLVKDEITKNVLLTEGYPKFVYGLISALMTIIP
IAKTPLNARPIVSVLDVLMNVQHIDEAASAIKRRAAKGLQVFNRIFINVVFVLIAINFPE
FDKIIAFLGAGLCFTICLILPCWFYLRLCKTTIKPWERVACHVTICISVVLSTLGVGAAI
IS
Download sequence
Identical sequences A6ZPW7 B3LQ99 C7GUT9 D3UF69 G2WH10 H0GIM2 P47082
YJR001W YJR001W YJR001W YJR001W YJR001W YJR001W YJR001W YJR001W YJR001W 4932.YJR001W YJR001W SCRT_03662 YJR001W tr|A6ZPW7|A6ZPW7_YEAS7 YJR001W YJR001W YJR001W

Jump to [ Top of page · Domain architecture · Domain assignment details ]