SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YJR001W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YJR001W   Protein: S000003761
Sequence length 602
Comment AVT1 SGDID:S000003761, Chr X from 436796-438604, Verified ORF, "Vacuolar transporter, imports large neutral amino acids into the vacuole; member of a family of seven S. cerevisiae genes (AVT1-7) related to vesicular GABA-glycine transporters"
Sequence
MPEQEPLSPNGRKRSEVHYISIPLNRGSAFSPDDSVSQFQSDGFMTRRQSILDHPVGSFK
GVNSLSRFATSLRRANSFRNIELNADNERSFFKESNDETYDPDTLAPALDGRRLSVTLNN
AGRPRITNLANNDRVSTASMAIHDDDYGSIQNSTIGDSGSILRPTASLTEMMSGGAGRRF
TNNDMDSIVVKRVEGVDGKVVTLLAGQSTAPQTIFNSINVLIGIGLLALPLGLKYAGWVI
GLTMLAIFALATFCTAELLSRCLDTDPTLISYADLGYAAFGTKGRALISALFTLDLLGSG
VSLVILFGDSLNALFPQYSTTFFKIVSFFIVTPPVFIPLSVLSNISLLGILSTTGTVLVI
CCCGLYKSSSPGSLVNPMETSMWPIDLKHLCLSIGLLSACWGGHAVFPNLKTDMRHPDKF
KDCLKTTYKITSVTDIGTAVIGFLMFGNLVKDEITKNVLLTEGYPKFVYGLISALMTIIP
IAKTPLNARPIVSVLDVLMNVQHIDEAASAIKRRAAKGLQVFNRIFINVVFVLIAINFPE
FDKIIAFLGAGLCFTICLILPCWFYLRLCKTTIKPWERVACHVTICISVVLSTLGVGAAI
IS
Download sequence
Identical sequences A6ZPW7 B3LQ99 C7GUT9 D3UF69 G2WH10 H0GIM2 N1NZZ6 P47082 W7Q111 W7RIE1
4932.YJR001W YJR001W YJR001W SCRT_03662 YJR001W YJR001W YJR001W tr|A6ZPW7|A6ZPW7_YEAS7 YJR001W YJR001W YJR001W YJR001W YJR001W YJR001W YJR001W YJR001W YJR001W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]