SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR005C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YJR005C-A   Protein: S000028523
Sequence length 93
Comment YJR005C-A SGDID:S000028523, Chr X from 448751-448470, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, originally identified as a syntenic homolog of an Ashbya gossypii gene"
Sequence
MHNTGKRYSETAKKVAAGRARKRRQAYEKDQLEKQQLEAQEAQRWEEGARTPNQKKLIME
QKKTEKLRAKKERDQLLAAEEEALGKGGRGKRY
Download sequence
Identical sequences A6ZPX2 B3LQA4 C7GUT6 D3UF72 N1P8L6 Q3E827 W7Q117 W7RIE7
SCRT_03667 YJR005C-A 4932.YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A tr|A6ZPX2|A6ZPX2_YEAS7 YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]