SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR005C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJR005C-A   Protein: S000028523
Sequence length 93
Comment YJR005C-A SGDID:S000028523, Chr X from 448751-448470, reverse complement, Uncharacterized ORF, "Putative protein of unknown function, originally identified as a syntenic homolog of an Ashbya gossypii gene"
Sequence
MHNTGKRYSETAKKVAAGRARKRRQAYEKDQLEKQQLEAQEAQRWEEGARTPNQKKLIME
QKKTEKLRAKKERDQLLAAEEEALGKGGRGKRY
Download sequence
Identical sequences A6ZPX2 B3LQA4 C7GUT6 D3UF72 N1P8L6 Q3E827 W7Q117 W7RIE7
YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A 4932.YJR005C-A YJR005C-A SCRT_03667 YJR005C-A YJR005C-A tr|A6ZPX2|A6ZPX2_YEAS7 YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A YJR005C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]