SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YJR010W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR010W
Domain Number 1 Region: 169-389
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 4.69e-89
Family ATP sulfurylase catalytic domain 0.00000000135
Further Details:      
 
Domain Number 2 Region: 3-168
Classification Level Classification E-value
Superfamily PUA domain-like 5.07e-52
Family ATP sulfurylase N-terminal domain 0.0000000196
Further Details:      
 
Domain Number 3 Region: 390-510
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-35
Family ATP sulfurylase C-terminal domain 0.000000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.999 25.69
chromosomal part 1.477 20.41
nucleoplasm part 1.418 15.58
endosome 1.325 14.24
cilium 1.611 13.15
extrinsic to plasma membrane 1.992 12.72
internal side of plasma membrane 2.099 12.51
extracellular organelle 1.593 12.36
ribonucleoprotein complex 1.418 9.43
transcription factor complex 1.882 9.42

Protein sequence

External link(s) Locus: YJR010W   Protein: S000003771
Sequence length 511
Comment MET3 SGDID:S000003771, Chr X from 456232-457767, Verified ORF, "ATP sulfurylase, catalyzes the primary step of intracellular sulfate activation, essential for assimilatory reduction of sulfate to sulfide, involved in methionine metabolism"
Sequence
MPAPHGGILQDLIARDALKKNELLSEAQSSDILVWNLTPRQLCDIELILNGGFSPLTGFL
NENDYSSVVTDSRLADGTLWTIPITLDVDEAFANQIKPDTRIALFQDDEIPIAILTVQDV
YKPNKTIEAEKVFRGDPEHPAISYLFNVAGDYYVGGSLEAIQLPQHYDYPGLRKTPAQLR
LEFQSRQWDRVVAFQTRNPMHRAHRELTVRAAREANAKVLIHPVVGLTKPGDIDHHTRVR
VYQEIIKRYPNGIAFLSLLPLAMRMSGDREAVWHAIIRKNYGASHFIVGRDHAGPGKNSK
GVDFYGPYDAQELVESYKHELDIEVVPFRMVTYLPDEDRYAPIDQIDTTKTRTLNISGTE
LRRRLRVGGEIPEWFSYPEVVKILRESNPPRPKQGFSIVLGNSLTVSREQLSIALLSTFL
QFGGGRYYKIFEHNNKTELLSLIQDFIGSGSGLIIPNQWEDDKDSVVGKQNVYLLDTSSS
ADIQLESADEPISHIVQKVVLFLEDNGFFVF
Download sequence
Identical sequences A6ZPX7 B3LQA9 C7GWK0 E7KED7 H0GIN0 N1P8M1 P08536 W7Q122 W7RIF2
4932.YJR010W YJR010W YJR010W YJR010W YJR010W YJR010W tr|A6ZPX7|A6ZPX7_YEAS7 YJR010W YJR010W YJR010W YJR010W YJR010W YJR010W YJR010W SCRT_03672 YJR010W YJR010W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]