SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR053W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJR053W   Protein: S000003814
Sequence length 574
Comment BFA1 SGDID:S000003814, Chr X from 534020-535744, Verified ORF, "Component of the GTPase-activating Bfa1p-Bub2p complex involved in multiple cell cycle checkpoint pathways that control exit from mitosis"
Sequence
MSIRPLTLNGLDEPETSFEELNTTLPRFQSHETLTLEENVPPLSTSTYIPPPSSVGTSDT
GTVFSNSTSAFWSNKQADDDQDMEVDQDDEFLNDFQEFQNKKDDFDDAIKTNFHLRNGCR
TGPFKNDIFAEEFDRKLSLEDKPRLKQPRSMMELKPKRKLSNSVTSRNLRSGNSVRFKKS
MPNLALVNPAIREEEEDEEREREDQREFNYKIDNDTQDTILAKFSSDDEGDFLTGFEELE
GEAIDETISSNDKESADHPRFLKKSSSSLPLKISPAQYDIVKHDELLTPGLHRRQRDWNT
QQELDSFKEKRSVRHCSNQNVQLNGPAKIKTIKQQIDHNTPMKKGSMIYNPKTMKWEGNE
NVLSKFSDVDTANRKALLIKNKLQRDADSKKQKYSDLQHARATSRNQKVIGNMILDEQNL
RWVSVSEEEADPFAGIPEINLPPVGKSMKKRSSSPFLRSKSQVNTPFVSNDNDGVYQSTA
AQARLRKYHSMRTLNGTTETPEISSTFHLSSRALEKFYHEENRWCKKLASWFIPRDETII
SVDEETIMDESTVNSKRKSYMYEIRNMVINSTKD
Download sequence
Identical sequences P47113
YJR053W YJR053W 4932.YJR053W YJR053W YJR053W

Jump to [ Top of page · Domain architecture · Domain assignment details ]