SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YJR064W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR064W
Domain Number 1 Region: 38-168,437-556
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.83e-79
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0022
Further Details:      
 
Domain Number 2 Region: 236-410
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.09e-47
Family Group II chaperonin (CCT, TRIC), apical domain 0.00042
Further Details:      
 
Domain Number 3 Region: 174-240,401-436
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 2.38e-29
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
unfolded protein binding 2.18 65.01
purine ribonucleoside binding 1.42 4.36
purine ribonucleoside triphosphate binding 1.453 4.36
adenyl ribonucleotide binding 1.479 4.06
Cellular Component IC (bits) H-Score
cell body 1.495 31.82
cytosol 1.307 29.29
sperm part 2.208 11.12
plastid 1.598 6.45
chloroplast part 1.897 6.45
secretory granule 1.827 5.2
plastid stroma 2.025 5.03
endocytic vesicle 1.435 4.56
organelle inner membrane 1.673 4.46
mitochondrial envelope 1.571 4.46

Protein sequence

External link(s) Locus: YJR064W   Protein: S000003825
Sequence length 562
Comment CCT5 SGDID:S000003825, Chr X from 555907-557595, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo"
Sequence
MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSHILAARSVASI
IKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTT
GVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFL
LRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLI
NGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT
YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNG
RIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCFVRGSNKMIVDEAE
RALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIP
MTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILL
ATQLCRMILKIDNVIISGKDEY
Download sequence
Identical sequences A6ZQ23 B3LQF2 B5VLL7 C8ZBL2 E7KEG6 E7KQJ6 E7QGT7 G2WH69 H0GIR9 N1P3H3 P40413 W7PPZ5 W7RCI3
SCRT_03717 YJR064W YJR064W YJR064W 3p9d.E 3p9d.M 3p9e.e 3p9e.m 4aol.E 4aol.e 4apk.E 4apk.e 4d8q.E 4d8q.M 4d8r.e 4d8r.m YJR064W YJR064W YJR064W YJR064W YJR064W 4932.YJR064W YJR064W YJR064W YJR064W YJR064w___KOG0357 tr|A6ZQ23|A6ZQ23_YEAS7 YJR064W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]