SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJR064W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR064W
Domain Number 1 Region: 38-168,437-556
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.83e-79
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0022
Further Details:      
 
Domain Number 2 Region: 236-410
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.09e-47
Family Group II chaperonin (CCT, TRIC), apical domain 0.00042
Further Details:      
 
Domain Number 3 Region: 174-240,401-436
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 2.38e-29
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
unfolded protein binding 2.082 52.46
Cellular Component IC (bits) H-Score
cytosol 1.295 19.53
mitochondrial matrix 1.611 6.55
host cell part 1.996 4.93
plastid 1.525 4.76
chloroplast stroma 2.009 4.76
polymeric cytoskeletal fiber 1.688 4.28
microtubule cytoskeleton 1.44 4.28
microtubule 1.891 4.28

Protein sequence

External link(s) Locus: YJR064W   Protein: S000003825
Sequence length 562
Comment CCT5 SGDID:S000003825, Chr X from 555907-557595, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo"
Sequence
MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSHILAARSVASI
IKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTT
GVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFL
LRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLI
NGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT
YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNG
RIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCFVRGSNKMIVDEAE
RALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIP
MTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILL
ATQLCRMILKIDNVIISGKDEY
Download sequence
Identical sequences A0A0L8VNB8 A6ZQ23 B3LQF2 B5VLL7 C8ZBL2 E7KEG6 E7KQJ6 E7QGT7 G2WH69 H0GIR9 N1P3H3 P40413
YJR064W YJR064W YJR064W YJR064W YJR064W tr|A6ZQ23|A6ZQ23_YEAS7 YJR064W SCRT_03717 4v81.E 4v81.M 4v81.e 4v81.m 4v8r.AE 4v8r.Ae 4v8r.BE 4v8r.Be 4v94.E 4v94.M 4v94.e 4v94.m 5gw4.E 5gw4.e 5gw5.E 5gw5.e YJR064W YJR064W YJR064w___KOG0357 YJR064W YJR064W 4932.YJR064W YJR064W YJR064W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]