SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR064W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR064W
Domain Number 1 Region: 38-168,437-556
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 1.83e-79
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.0022
Further Details:      
 
Domain Number 2 Region: 236-410
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.09e-47
Family Group II chaperonin (CCT, TRIC), apical domain 0.00042
Further Details:      
 
Domain Number 3 Region: 174-240,401-436
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 2.38e-29
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.0037
Further Details:      
 

Protein sequence

External link(s) Locus: YJR064W   Protein: S000003825
Sequence length 562
Comment CCT5 SGDID:S000003825, Chr X from 555907-557595, Verified ORF, "Subunit of the cytosolic chaperonin Cct ring complex, related to Tcp1p, required for the assembly of actin and tubulins in vivo"
Sequence
MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSHILAARSVASI
IKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTT
GVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLEETCDDISASNDELFRDFL
LRAAKTSLGSKIVSKDHDRFAEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLI
NGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT
YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNG
RIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCFVRGSNKMIVDEAE
RALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIP
MTLAENSGLDPIGTLSTLKSKQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILL
ATQLCRMILKIDNVIISGKDEY
Download sequence
Identical sequences A6ZQ23 B3LQF2 B5VLL7 C8ZBL2 E7KEG6 E7KQJ6 E7QGT7 G2WH69 H0GIR9 P40413
YJR064W YJR064W YJR064W YJR064W YJR064W YJR064W YJR064W YJR064W 4932.YJR064W YJR064W SCRT_03717 YJR064W YJR064W tr|A6ZQ23|A6ZQ23_YEAS7 YJR064W 3p9d.E 3p9d.M 3p9e.e 3p9e.m 4aol.E 4aol.e 4apk.E 4apk.e 4d8q.E 4d8q.M 4d8r.e 4d8r.m YJR064w___KOG0357

Jump to [ Top of page · Domain architecture · Domain assignment details ]