SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJR065C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR065C
Domain Number 1 Region: 201-443
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.02e-71
Family Actin/HSP70 0.0000000673
Further Details:      
 
Domain Number 2 Region: 5-39,80-193
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.98e-43
Family Actin/HSP70 0.00000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
focal adhesion 1.767 32.16
cell-substrate junction 1.512 29.81
actin-based cell projection 1.641 25.34
cell leading edge 1.403 19.88
chromosomal part 1.456 16.38
nuclear chromosome part 1.803 16.38
chromatin 1.848 16.38
transporter complex 1.655 14.53
cell body 1.514 14.18
actin cytoskeleton 1.332 13.85

Protein sequence

External link(s) Locus: YJR065C   Protein: S000003826
Sequence length 449
Comment ARP3 SGDID:S000003826, Chr X from 559151-557802, reverse complement, Verified ORF, "Essential component of the Arp2/3 complex, which is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity"
Sequence
MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEA
SYFGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQ
VENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIA
VQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITL
FIQSLLRERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRR
KVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGST
MFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTA
EFKGYCHTKKDYEEYGPEIVRNFSLFNMV
Download sequence
Identical sequences P47117
YJR065C YJR065C YJR065C 4932.YJR065C YJR065C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]