SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR065C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR065C
Domain Number 1 Region: 201-443
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.02e-71
Family Actin/HSP70 6.73e-08
Further Details:      
 
Domain Number 2 Region: 5-39,80-193
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.98e-43
Family Actin/HSP70 5.88e-06
Further Details:      
 

Protein sequence

External link(s) Locus: YJR065C   Protein: S000003826
Sequence length 449
Comment ARP3 SGDID:S000003826, Chr X from 559151-557802, reverse complement, Verified ORF, "Essential component of the Arp2/3 complex, which is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity"
Sequence
MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEA
SYFGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQ
VENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIA
VQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITL
FIQSLLRERGEADTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRR
KVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGST
MFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTA
EFKGYCHTKKDYEEYGPEIVRNFSLFNMV
Download sequence
Identical sequences P47117
YJR065C YJR065C 4932.YJR065C YJR065C YJR065C

Jump to [ Top of page · Domain architecture · Domain assignment details ]