SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR067C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YJR067C   Protein: S000003828
Sequence length 141
Comment YAE1 SGDID:S000003828, Chr X from 567437-567012, reverse complement, Verified ORF, "Essential protein of unknown function"
Sequence
MSNTWDDVWASDSDVETERSPDLVKLRENHSKRGYLDGIVSSKEEKLQEGFNDGFPTGAK
LGKQVGIIMGILLGLRTRFGDEDEDLSKAYIDAQKELRINKVLSKSIFDPNFDLQEKHPL
ITKWTDIANTYCEKYHVPSIQ
Download sequence
Identical sequences B3LQF4 C8ZBL5 E7KEG8 E7KQJ8 E7LWE8 H0GIS2 P47118 W7Q159 W7R068
YJR067C YJR067C SCRT_03720 YJR067C YJR067C GO.94592 YT37 YJR067C YJR067C YJR067C 4932.YJR067C YJR067C YJR067C YJR067C YJR067C YJR067C YJR067C YJR067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]