SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR076C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR076C
Domain Number 1 Region: 5-196
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.48e-25
Family G proteins 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule cytoskeleton 1.341 26.13
microtubule associated complex 1.998 25.22
chromosomal part 1.477 20.37
cilium 1.573 16.39
nucleoplasm part 1.496 15.57
endosome 1.323 14.1
extrinsic component of plasma membrane 1.992 13.97
extracellular organelle 1.606 12.21
SWI/SNF superfamily-type complex 2.178 9.4
lateral plasma membrane 1.933 9.04

Protein sequence

External link(s) Locus: YJR076C   Protein: S000003837
Sequence length 415
Comment CDC11 SGDID:S000003837, Chr X from 576594-575347, reverse complement, Verified ORF, "Component of the septin ring of the mother-bud neck that is required for cytokinesis; septins recruit proteins to the neck and can act as a barrier to diffusion at the membrane, and they comprise the 10nm filaments seen with EM"
Sequence
MSGIIDASSALRKRKHLKRGITFTVMIVGQSGSGRSTFINTLCGQQVVDTSTTILLPTDT
STEIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPSFEIISDYIRHQYDEILLE
ESRVRRNPRFKDGRVHCCLYLINPTGHGLKEIDVEFIRQLGSLVNIIPVISKSDSLTRDE
LKLNKKLIMEDIDRWNLPIYNFPFDEDEISDEDYETNMYLRTLLPFAIIGSNEVYEMGGD
VGTIRGRKYPWGILDVEDSSISDFVILRNALLISHLHDLKNYTHEILYERYRTEALSGES
VAAESIRPNLTKLNGSSSSSTTTRRNTNPFKQSNNINNDVLNPASDMHGQSTGENNETYM
TREEQIRLEEERLKAFEERVQQELLLKRQELLQREKELREIEARLEKEAKIKQEE
Download sequence
Identical sequences A6ZQ34 B3LQG2 B5VLM8 C7GMC8 C8ZBM3 E7Q5Q2 E7QGU5 G2WH80 N1P053 P32458 W7PRZ4 W7RCJ8
YJR076C tr|A6ZQ34|A6ZQ34_YEAS7 YJR076C YJR076C YJR076C YJR076C YJR076C YJR076C YJR076C YJR076C YJR076C YJR076C 4932.YJR076C YJR076C YJR076C YJR076C YJR076C YJR076C YJR076C SCRT_03728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]