SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR090C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR090C
Domain Number 1 Region: 433-698
Classification Level Classification E-value
Superfamily RNI-like 1.16e-39
Family 28-residue LRR 0.077
Further Details:      
 
Domain Number 2 Region: 188-229,390-469
Classification Level Classification E-value
Superfamily RNI-like 1.06e-07
Family 28-residue LRR 0.085
Further Details:      
 
Weak hits

Sequence:  YJR090C
Domain Number - Region: 306-353
Classification Level Classification E-value
Superfamily F-box domain 0.000213
Family F-box domain 0.0078
Further Details:      
 
Domain Number - Region: 706-741
Classification Level Classification E-value
Superfamily RNI-like 0.00863
Family Cyclin A/CDK2-associated p19, Skp2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 27.62
receptor complex 1.511 18.31
nucleoplasm part 1.418 13.64
nuclear chromosome 1.72 7.32
chromosomal part 1.477 7.32
replication fork 2.198 7.32
fusome 2.198 7.11
cell body 1.495 5.95

Protein sequence

External link(s) Locus: YJR090C   Protein: S000003850
Sequence length 1151
Comment GRR1 SGDID:S000003850, Chr X from 594320-590865, reverse complement, Verified ORF, "F-box protein component of the SCF ubiquitin-ligase complex; involved in carbon catabolite repression, glucose-dependent divalent cation transport, high-affinity glucose transport, morphogenesis, and sulfite detoxification"
Sequence
MDQDNNNHNDSNRLHPPDIHPNLGPQLWLNSSGDFDDNNNNNNNNNNNNSTRPQMPSRTR
ETATSERNASEVRDATLNNIFRFDSIQRETLLPTNNGQPLNQNFSLTFQPQQQTNALNGI
DINTVNTNLMNGVNVQIDQLNRLLPNLPEEERKQIHEFKLIVGKKIQEFLVVIEKRRKKI
LNEIELDNLKLKELRIDNSPQAISYLHKLQRMRLRALETENMEIRNLRLKILTIIEEYKK
SLYAYCHSKLRGQQVENPTDNFIIWINSIDTTESSDLKEGLQDLSRYSRQFINNVLSNPS
NQNICTSVTRRSPVFALNMLPSEILHLILDKLNQKYDIVKFLTVSKLWAEIIVKILYYRP
HINKKSQLDLFLRTMKLTSEETVFNYRLMIKRLNFSFVGDYMHDTELNYFVGCKNLERLT
LVFCKHITSVPISAVLRGCKFLQSVDITGIRDVSDDVFDTLATYCPRVQGFYVPQARNVT
FDSLRNFIVHSPMLKRIKITANNNMNDELVELLANKCPLLVEVDITLSPNVTDSSLLKLL
TRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDKTIESIVNLAPK
LRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRALFHSCTRIQYVDFAC
CTNLTNRTLYELADLPKLKRIGLVKCTQMTDEGLLNMVSLRGRNDTLERVHLSYCSNLTI
YPIYELLMSCPRLSHLSLTAVPSFLRPDITMYCRPAPSDFSENQRQIFCVFSGKGVHKLR
HYLVNLTSPAFGPHVDVNDVLTKYIRSKNLIFNGETLEDALRRIITDLNQDSAAIIAATG
LNQINGLNNDFLFQNINFERIDEVFSWYLNTFDGIRMSSEEVNSLLLQVNKTFCEDPFSD
VDDDQDYVVAPGVNREINSEMCHIVRKFHELNDHIDDFEVNVASLVRVQFQFTGFLLHEM
TQTYMQMIELNRQICLVQKTVQESGNIDYQKGLLIWRLLFIDKFIMVVQKYKLSTVVLRL
YLKDNITLLTRQRELLIAHQRSAWNNNNDNDANRNANNIVNIVSDAGANDTSNNETNNGN
DDNETENPNFWRQFGNRMQISPDQMRNLQMGLRNQNMVRNNNNNTIDESMPDTAIDSQMD
EASGTPDEDML
Download sequence
Identical sequences P24814
YJR090C YJR090C 4932.YJR090C YJR090C YJR090C YJR090C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]