SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR090C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR090C
Domain Number 1 Region: 433-698
Classification Level Classification E-value
Superfamily RNI-like 1.16e-39
Family 28-residue LRR 0.077
Further Details:      
 
Domain Number 2 Region: 188-229,390-469
Classification Level Classification E-value
Superfamily RNI-like 1.06e-07
Family 28-residue LRR 0.085
Further Details:      
 
Weak hits

Sequence:  YJR090C
Domain Number - Region: 306-353
Classification Level Classification E-value
Superfamily F-box domain 0.000213
Family F-box domain 0.0078
Further Details:      
 
Domain Number - Region: 706-741
Classification Level Classification E-value
Superfamily RNI-like 0.00863
Family Cyclin A/CDK2-associated p19, Skp2 0.011
Further Details:      
 

Protein sequence

External link(s) Locus: YJR090C   Protein: S000003850
Sequence length 1151
Comment GRR1 SGDID:S000003850, Chr X from 594320-590865, reverse complement, Verified ORF, "F-box protein component of the SCF ubiquitin-ligase complex; involved in carbon catabolite repression, glucose-dependent divalent cation transport, high-affinity glucose transport, morphogenesis, and sulfite detoxification"
Sequence
MDQDNNNHNDSNRLHPPDIHPNLGPQLWLNSSGDFDDNNNNNNNNNNNNSTRPQMPSRTR
ETATSERNASEVRDATLNNIFRFDSIQRETLLPTNNGQPLNQNFSLTFQPQQQTNALNGI
DINTVNTNLMNGVNVQIDQLNRLLPNLPEEERKQIHEFKLIVGKKIQEFLVVIEKRRKKI
LNEIELDNLKLKELRIDNSPQAISYLHKLQRMRLRALETENMEIRNLRLKILTIIEEYKK
SLYAYCHSKLRGQQVENPTDNFIIWINSIDTTESSDLKEGLQDLSRYSRQFINNVLSNPS
NQNICTSVTRRSPVFALNMLPSEILHLILDKLNQKYDIVKFLTVSKLWAEIIVKILYYRP
HINKKSQLDLFLRTMKLTSEETVFNYRLMIKRLNFSFVGDYMHDTELNYFVGCKNLERLT
LVFCKHITSVPISAVLRGCKFLQSVDITGIRDVSDDVFDTLATYCPRVQGFYVPQARNVT
FDSLRNFIVHSPMLKRIKITANNNMNDELVELLANKCPLLVEVDITLSPNVTDSSLLKLL
TRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDKTIESIVNLAPK
LRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRALFHSCTRIQYVDFAC
CTNLTNRTLYELADLPKLKRIGLVKCTQMTDEGLLNMVSLRGRNDTLERVHLSYCSNLTI
YPIYELLMSCPRLSHLSLTAVPSFLRPDITMYCRPAPSDFSENQRQIFCVFSGKGVHKLR
HYLVNLTSPAFGPHVDVNDVLTKYIRSKNLIFNGETLEDALRRIITDLNQDSAAIIAATG
LNQINGLNNDFLFQNINFERIDEVFSWYLNTFDGIRMSSEEVNSLLLQVNKTFCEDPFSD
VDDDQDYVVAPGVNREINSEMCHIVRKFHELNDHIDDFEVNVASLVRVQFQFTGFLLHEM
TQTYMQMIELNRQICLVQKTVQESGNIDYQKGLLIWRLLFIDKFIMVVQKYKLSTVVLRL
YLKDNITLLTRQRELLIAHQRSAWNNNNDNDANRNANNIVNIVSDAGANDTSNNETNNGN
DDNETENPNFWRQFGNRMQISPDQMRNLQMGLRNQNMVRNNNNNTIDESMPDTAIDSQMD
EASGTPDEDML
Download sequence
Identical sequences P24814
YJR090C YJR090C 4932.YJR090C YJR090C YJR090C YJR090C

Jump to [ Top of page · Domain architecture · Domain assignment details ]