SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR104C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR104C
Domain Number 1 Region: 4-152
Classification Level Classification E-value
Superfamily Cu,Zn superoxide dismutase-like 4.71e-55
Family Cu,Zn superoxide dismutase-like 0.0000000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
copper ion binding 2.103 55.59
enzyme activator activity 1.376 10.67
phosphatase binding 1.998 9.52
Cellular Component IC (bits) H-Score
extracellular space 1.521 22
dendrite 1.585 17.1
cell body 1.498 12.29
microbody 1.95 6.32
mitochondrial envelope 1.573 5.93
mitochondrial intermembrane space 2.197 5.49
trans-Golgi network 1.793 4.83
cytosol 1.301 4.66

Protein sequence

External link(s) Locus: YJR104C   Protein: S000003865
Sequence length 154
Comment SOD1 SGDID:S000003865, Chr X from 623003-622539, reverse complement, Verified ORF, "Cytosolic superoxide dismutase; some mutations are analogous to those that cause ALS (amyotrophic lateral sclerosis) in humans"
Sequence
MVQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEFGDATNGCVS
AGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFKDSLIKLIGPTSVVGRSVVI
HAGQDDLGKGDTEESLKTGNAGPRPACGVIGLTN
Download sequence
Identical sequences A6ZQ60 C7GMA4 C8ZBQ1 E7KEJ3 E7KQM4 E7LWH5 E7NJI0 E7Q5R9 E7QGW1 G2WHA7 H0GIV2 N1P179 P00445 W7PS17 W7RCM5
YJR104C YJR104C YJR104C 1f1g.A 1f1g.B 1f1g.C 1f1g.D 1f1g.E 1f1g.F YJR104C YJR104C YJR104C YJR104C YJR104C tr|A6ZQ60|A6ZQ60_YEAS7 YJR104C YJR104C YJR104C YJR104C YJR104C 1f1gA YJR104c___KOG0441 YJR104C YJR104C YJR104C 4932.YJR104C YJR104C YJR104C YJR104C YJR104C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]