SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR135W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR135W-A
Domain Number 1 Region: 31-85
Classification Level Classification E-value
Superfamily Tim10-like 1.7e-18
Family Tim10/DDP 0.0026
Further Details:      
 

Protein sequence

External link(s) Locus: YJR135W-A   Protein: S000007348
Sequence length 87
Comment TIM8 SGDID:S000007348, Chr X from 676962-677225, Verified ORF, "Mitochondrial intermembrane space protein mediating import and insertion of polytopic inner membrane proteins; homolog of human DDP1 (deafness dystonia peptide 1) which is mutated in the X-linked Mohr-Tranebjaerg syndrome"
Sequence
MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQ
EEQCLSNCVNRFLDTNIRIVNGLQNTR
Download sequence
Identical sequences A6ZQ91 B3LQL8 C7GM77 C8ZBT4 G2WHD8 P57744
YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A 355435 YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A 4932.YJR135W-A YJR135W-A SCRT_03787 YJR135W-A YJR135W-A tr|A6ZQ91|A6ZQ91_YEAS7 YJR135W-A YJR135W-A YJR135W-A YJR135w-a___KOG3489 YJR135W-A YJR135W-A YJR135W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]