SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJR135W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR135W-A
Domain Number 1 Region: 31-85
Classification Level Classification E-value
Superfamily Tim10-like 1.7e-18
Family Tim10/DDP 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
protein transporter activity 2.138 74.12
active transmembrane transporter activity 1.679 3.17
Cellular Component IC (bits) H-Score
organelle envelope lumen 2.229 89.72
mitochondrial envelope 1.593 41.64
transporter complex 1.657 32.12
organelle inner membrane 1.692 10.56
inner mitochondrial membrane protein complex 1.909 4.62

Protein sequence

External link(s) Locus: YJR135W-A   Protein: S000007348
Sequence length 87
Comment TIM8 SGDID:S000007348, Chr X from 676962-677225, Verified ORF, "Mitochondrial intermembrane space protein mediating import and insertion of polytopic inner membrane proteins; homolog of human DDP1 (deafness dystonia peptide 1) which is mutated in the X-linked Mohr-Tranebjaerg syndrome"
Sequence
MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVESVNDSNLSSQ
EEQCLSNCVNRFLDTNIRIVNGLQNTR
Download sequence
Identical sequences A6ZQ91 B3LQL8 C7GM77 C8ZBT4 G2WHD8 N1P3Q3 P57744 W7PS44 W7RCP4
YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A 355435 4932.YJR135W-A YJR135W-A YJR135W-A YJR135W-A SCRT_03787 YJR135W-A YJR135W-A YJR135W-A YJR135w-a___KOG3489 tr|A6ZQ91|A6ZQ91_YEAS7 YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A YJR135W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]