SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YJR140W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YJR140W-A   Protein: S000028666
Sequence length 49
Comment YJR140W-A SGDID:S000028666, Chr X from 690952-691101, Dubious ORF, "Dubious open reading frame; completely overlaps the verified gene HIR3; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MPKQTLSNAIPLCPFFNWKASFNPDDISSGYFPWSKTWFSCSLIFRNSW
Download sequence
Identical sequences C8ZBU0 Q8TGN1
YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A 4932.YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]