SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR140W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJR140W-A   Protein: S000028666
Sequence length 49
Comment YJR140W-A SGDID:S000028666, Chr X from 690952-691101, Dubious ORF, "Dubious open reading frame; completely overlaps the verified gene HIR3; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching"
Sequence
MPKQTLSNAIPLCPFFNWKASFNPDDISSGYFPWSKTWFSCSLIFRNSW
Download sequence
Identical sequences C8ZBU0 Q8TGN1
YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A 4932.YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A YJR140W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]