SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJR145C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR145C
Domain Number 1 Region: 53-93
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000125
Family YbcJ-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribosomal subunit 1.948 10.55
intracellular ribonucleoprotein complex 1.323 8.52
mitochondrial matrix 1.568 8.09
mitochondrial ribosome 2.079 8.09
cytosolic ribosome 2.062 5.47
cytosolic part 1.678 5.32
Biological Process IC (bits) H-Score
RNA processing 1.497 74.65
ncRNA processing 1.821 74.65
ribosome biogenesis 1.945 25.45
RNA modification 2.202 12.04
translation 1.516 9.07
ncRNA metabolic process 1.499 6.29
mitochondrion organization 1.534 4.5
mitochondrial RNA metabolic process 2.241 4.26
rRNA metabolic process 2.134 3.57
tRNA aminoacylation for protein translation 1.966 3.42
Molecular Function IC (bits) H-Score
aminoacyl-tRNA ligase activity 1.893 105.58
intramolecular transferase activity 2.107 29.62
isomerase activity 1.598 14.22
structural constituent of ribosome 1.965 13.35
RNA binding 1.279 4.24

Protein sequence

External link(s) Locus: YJR145C   Protein: S000003906
Sequence length 261
Comment RPS4A SGDID:S000003906, Chr X from 703059-703046,702789-702018, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein"
Sequence
MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGRE
VKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRLVYDVKGRFAVHRITDEEAS
YKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTVKIDLASGKITDFIKFDAGKL
VYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPK
GKGIKLSIAEERDRRRAQQGL
Download sequence
Identical sequences A6ZQA2 B3LQM5 C8ZA04 G2WFS7 N1P4X8 P0CX35 P0CX36 W7PS53 W7R9Q2
YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YR102 YHR203C YJR145C 1vw9.F 1vwv.F 1vxw.E 1vxz.E 3izb.D 3u5c.E 3u5g.E 4byl.E 4byt.E SCRT_03797 SCRT_04917 tr|A6ZQA2|A6ZQA2_YEAS7 YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YJR145C 4932.YHR203C 4932.YJR145C YHR203C YJR145C YHR203C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YHR203C YJR145C YHR203C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]