SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR145C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR145C
Domain Number 1 Region: 53-93
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 1.25e-05
Family YbcJ-like 0.077
Further Details:      
 

Protein sequence

External link(s) Locus: YJR145C   Protein: S000003906
Sequence length 261
Comment RPS4A SGDID:S000003906, Chr X from 703059-703046,702789-702018, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein"
Sequence
MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGRE
VKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRLVYDVKGRFAVHRITDEEAS
YKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTVKIDLASGKITDFIKFDAGKL
VYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPK
GKGIKLSIAEERDRRRAQQGL
Download sequence
Identical sequences A6ZQA2 B3LQM5 C8ZA04 G2WFS7 P0CX35 P0CX36
YHR203C YJR145C YHR203C YJR145C YHR203C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YHR203C YJR145C YJR145C YR102 YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C 4932.YHR203C 4932.YJR145C YHR203C YJR145C SCRT_03797 SCRT_04917 YHR203C YJR145C tr|A6ZQA2|A6ZQA2_YEAS7 3izb.D 3u5c.E 3u5g.E YHR203C YJR145C YHR203C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C

Jump to [ Top of page · Domain architecture · Domain assignment details ]