SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR145C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR145C
Domain Number 1 Region: 53-93
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000125
Family YbcJ-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
RNA processing 1.457 74.23
rRNA metabolic process 2.197 74.23
ncRNA processing 1.878 74.23
ribosome biogenesis 2.068 21.04
tRNA aminoacylation 2.003 17.36
RNA modification 2.179 10.01
translation 1.518 9.25
ncRNA metabolic process 1.572 6.38
mitochondrion organization 1.548 4.91
Molecular Function IC (bits) H-Score
aminoacyl-tRNA ligase activity 1.978 89.77
intramolecular transferase activity 2.227 25.21
structural constituent of ribosome 1.984 13.82
isomerase activity 1.67 12.16
RNA binding 1.324 4.24
Cellular Component IC (bits) H-Score
ribosomal subunit 2.011 13.43
ribonucleoprotein complex 1.414 11.21
organellar ribosome 2.15 7.97
cytosol 1.301 6.4
cytosolic ribosome 2.218 4.11
mitochondrial matrix 1.714 3.96

Protein sequence

External link(s) Locus: YJR145C   Protein: S000003906
Sequence length 261
Comment RPS4A SGDID:S000003906, Chr X from 703059-703046,702789-702018, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein"
Sequence
MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGRE
VKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRLVYDVKGRFAVHRITDEEAS
YKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTVKIDLASGKITDFIKFDAGKL
VYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPK
GKGIKLSIAEERDRRRAQQGL
Download sequence
Identical sequences A6ZQA2 B3LQM5 C8ZA04 G2WFS7 N1P4X8 P0CX35 P0CX36 W7PS53 W7R9Q2
4932.YHR203C 4932.YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C SCRT_03797 SCRT_04917 YHR203C YHR203C YJR145C YR102 YHR203C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C 1vw9.F 1vwv.F 1vxw.E 1vxz.E 3izb.D 3u5c.E 3u5g.E 4byl.E 4byt.E YHR203C YHR203C YJR145C YHR203C YJR145C tr|A6ZQA2|A6ZQA2_YEAS7 YHR203C YJR145C YHR203C YJR145C YJR145C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]