SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJR145C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR145C
Domain Number 1 Region: 53-93
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0000125
Family YbcJ-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
aminoacyl-tRNA ligase activity 1.831 109.54
intramolecular transferase activity 2.132 29.37
structural constituent of ribosome 1.959 17.36
isomerase activity 1.595 13.99
Cellular Component IC (bits) H-Score
ribosomal subunit 1.983 11.43
intracellular ribonucleoprotein complex 1.368 8.93
mitochondrial matrix 1.611 7.47
cytosol 1.295 6.36
organellar ribosome 2.107 6.24
cytosolic ribosome 2.235 4.67
Biological Process IC (bits) H-Score
tRNA aminoacylation for protein translation 1.941 109.54
RNA processing 1.499 74.68
rRNA metabolic process 2.071 74.68
ncRNA processing 1.837 74.68
ribosome biogenesis 1.853 27.25
ribonucleoprotein complex biogenesis 1.7 23.29
RNA modification 2.218 11.81
translation 1.514 9.92
ncRNA metabolic process 1.491 6.2

Protein sequence

External link(s) Locus: YJR145C   Protein: S000003906
Sequence length 261
Comment RPS4A SGDID:S000003906, Chr X from 703059-703046,702789-702018, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; mutation affects 20S pre-rRNA processing; identical to Rps4Bp and has similarity to rat S4 ribosomal protein"
Sequence
MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNRLKYALNGRE
VKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRLVYDVKGRFAVHRITDEEAS
YKLGKVKKVQLGKKGVPYVVTHDGRTIRYPDPNIKVNDTVKIDLASGKITDFIKFDAGKL
VYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPK
GKGIKLSIAEERDRRRAQQGL
Download sequence
Identical sequences A0A0L8VQB1 A6ZQA2 B3LQM5 C8ZA04 G2WFS7 N1P4X8 P0CX35 P0CX36
YHR203C YJR145C YHR203C tr|A6ZQA2|A6ZQA2_YEAS7 YHR203C YJR145C YHR203C YJR145C 3j6x.S4 3j6y.S4 3j77.S4 3j78.S4 4v6i.AD 4v88.AE 4v88.CE 4v8y.AE 4v8z.AE 5juo.BB 5jup.BB 5jus.BB 5jut.BB 5juu.BB 5ll6.S 5mc6.S 5tzs.5 5wyj.SF 5wyk.SF YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YJR145C 4932.YHR203C 4932.YJR145C YHR203C YJR145C YHR203C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YR102 YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C YJR145C YHR203C SCRT_03797 SCRT_04917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]