SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR162C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YJR162C   Protein: S000003923
Sequence length 116
Comment YJR162C SGDID:S000003923, Chr X from 745252-744902, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MLQYIPLSNLPYSHIPLHHPSLTISTKCTRIIMHGTCLSGLYPVPFTHNSHDYPHFNIYI
SFGGPKYCITALNTYVIPLLHRILTTQFIYTYANITKKSPLKSPKHKNILFFNHNT
Download sequence
Identical sequences P47188
YJR162C 4932.YJR162C YJR162C YJR162C YJR162C YJR162C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]