SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YJR162C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YJR162C   Protein: S000003923
Sequence length 116
Comment YJR162C SGDID:S000003923, Chr X from 745252-744902, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MLQYIPLSNLPYSHIPLHHPSLTISTKCTRIIMHGTCLSGLYPVPFTHNSHDYPHFNIYI
SFGGPKYCITALNTYVIPLLHRILTTQFIYTYANITKKSPLKSPKHKNILFFNHNT
Download sequence
Identical sequences P47188
YJR162C YJR162C YJR162C 4932.YJR162C YJR162C YJR162C

Jump to [ Top of page · Domain architecture · Domain assignment details ]