SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL023C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YKL023C-A   Protein: S000113559
Sequence length 75
Comment YKL023C-A SGDID:S000113559, Chr XI from 393016-392789, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MNPRYRFILRFYSSKKPTFHNTAPSKTNVNVPRANKSQSKGKHKGKLLVLVGTLALVTSV
ISVNYQKNEPVEFLE
Download sequence
Identical sequences A6ZZU0 B3LR60 C7GRI3 G2WI06 Q2V2P3
YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A 4932.YKL023C-A YKL023C-A SCRT_03995 YKL023C-A YKL023C-A tr|A6ZZU0|A6ZZU0_YEAS7 YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]