SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL023C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YKL023C-A   Protein: S000113559
Sequence length 75
Comment YKL023C-A SGDID:S000113559, Chr XI from 393016-392789, reverse complement, Uncharacterized ORF, "Putative protein of unknown function"
Sequence
MNPRYRFILRFYSSKKPTFHNTAPSKTNVNVPRANKSQSKGKHKGKLLVLVGTLALVTSV
ISVNYQKNEPVEFLE
Download sequence
Identical sequences A6ZZU0 B3LR60 C7GRI3 G2WI06 Q2V2P3
tr|A6ZZU0|A6ZZU0_YEAS7 YKL023C-A YKL023C-A SCRT_03995 YKL023C-A YKL023C-A YKL023C-A YKL023C-A 4932.YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A YKL023C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]