SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL035W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL035W
Domain Number 1 Region: 25-478
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.37e-103
Family UDP-glucose pyrophosphorylase 5.67e-09
Further Details:      
 

Protein sequence

External link(s) Locus: YKL035W   Protein: S000001518
Sequence length 499
Comment UGP1 SGDID:S000001518, Chr XI from 369534-371033, Verified ORF, "UDP-glucose pyrophosphorylase (UGPase), catalyses the reversible formation of UDP-Glc from glucose 1-phosphate and UTP, involved in a wide variety of metabolic pathways, expression modulated by Pho85p through Pho4p"
Sequence
MSTKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSSKLDDAARAKFENELDSFFTLFR
RYLVEKSSRTTLEWDKIKSPNPDEVVKYEIISQQPENVSNLSKLAVLKLNGGLGTSMGCV
GPKSVIEVREGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSANRIR
IRSFNQSRFPRVYKDSLLPVPTEYDSPLDAWYPPGHGDLFESLHVSGELDALIAQGREIL
FVSNGDNLGATVDLKILNHMIETGAEYIMELTDKTRADVKGGTLISYDGQVRLLEVAQVP
KEHIDEFKNIRKFTNFNTNNLWINLKAVKRLIESSNLEMEIIPNQKTITRDGHEINVLQL
ETACGAAIRHFDGAHGVVVPRSRFLPVKTCSDLLLVKSDLFRLEHGSLKLDPSRFGPNPL
IKLGSHFKKVSGFNARIPHIPKIVELDHLTITGNVFLGKDVTLRGTVIIVCSDGHKIDIP
NGSILENVVVTGNLQILEH
Download sequence
Identical sequences A6ZZS9 B3LR51 B5VMB9 C7GP37 C8ZCD4 E7LWW8 E7QHB1 H0GJ94 N1P7W9 P32861 W7PR09 W7QVU2
YKL035W YKL035W YKL035W YKL035W YKL035W YKL035W YKL035W YKL035W YKL035W 4932.YKL035W YKL035W SCRT_03984 YKL035W tr|A6ZZS9|A6ZZS9_YEAS7 YKL035W YKL035w___KOG2638 YKL035W YKL035W YKL035W

Jump to [ Top of page · Domain architecture · Domain assignment details ]