SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL081W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL081W
Domain Number 1 Region: 251-412
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.31e-67
Family eEF1-gamma domain 1.69e-05
Further Details:      
 
Domain Number 2 Region: 68-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.92e-25
Family Glutathione S-transferase (GST), C-terminal domain 5.16e-05
Further Details:      
 
Domain Number 3 Region: 1-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.84e-11
Family Glutathione S-transferase (GST), N-terminal domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
endoplasmic reticulum lumen 2.107 22.31
mitochondrial envelope 1.579 9.52
mitochondrial membrane part 1.918 9.52
plastid 1.598 9.2
endoplasmic reticulum part 1.433 8.59
internal side of plasma membrane 2.099 8.02
sarcoplasmic reticulum 1.999 7.45
cilium 1.617 7.21
cilium part 1.918 7.21
respiratory chain 2.141 6.44

Protein sequence

External link(s) Locus: YKL081W   Protein: S000001564
Sequence length 412
Comment TEF4 SGDID:S000001564, Chr XI from 282535-282739,283066-284099, Verified ORF, "Translation elongation factor EF-1 gamma"
Sequence
MSQGTLYINRSPRNYASEALISYFKLDVKIVDLEQSSEFASLFPLKQAPAFLGPKGLKLT
EALAIQFYLANQVADEKERARLLGSDVIEKSQILRWASLANSDVMSNIARPFLSFKGLIP
YNKKDVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPEWRA
KHPHLMRWFNTVAASPIVKTPFAEVKLAEKALTYTPPKKQKAEKPKAEKSKAEKKKDEAK
PADDAAPAKKPKHPLEALGKSTFVLDDWKRKYSNDDTRPVALPWFWEHYNPEEYSIWKVG
YKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDFAPA
FDVAPDWESYEYTKLDPTKEEDKEFVNNMWAWDKPVVVNGEDKEIVDGKVLK
Download sequence
Identical sequences B3LR10 N1P2A1 P36008 W7QWF1
YKL081W YKL081W 4932.YKL081W YKL081W YKL081W SCRT_03940 YKL081W YKL081W YKL081W YKL081W YKL081W YKL081W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]