SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL081W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL081W
Domain Number 1 Region: 251-412
Classification Level Classification E-value
Superfamily eEF1-gamma domain 1.31e-67
Family eEF1-gamma domain 1.69e-05
Further Details:      
 
Domain Number 2 Region: 68-210
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.92e-25
Family Glutathione S-transferase (GST), C-terminal domain 5.16e-05
Further Details:      
 
Domain Number 3 Region: 1-72
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.84e-11
Family Glutathione S-transferase (GST), N-terminal domain 0.00053
Further Details:      
 

Protein sequence

External link(s) Locus: YKL081W   Protein: S000001564
Sequence length 412
Comment TEF4 SGDID:S000001564, Chr XI from 282535-282739,283066-284099, Verified ORF, "Translation elongation factor EF-1 gamma"
Sequence
MSQGTLYINRSPRNYASEALISYFKLDVKIVDLEQSSEFASLFPLKQAPAFLGPKGLKLT
EALAIQFYLANQVADEKERARLLGSDVIEKSQILRWASLANSDVMSNIARPFLSFKGLIP
YNKKDVDACFVKIDNLAAVFDARLRDYTFVATENISLGDLHAAGSWAFGLATILGPEWRA
KHPHLMRWFNTVAASPIVKTPFAEVKLAEKALTYTPPKKQKAEKPKAEKSKAEKKKDEAK
PADDAAPAKKPKHPLEALGKSTFVLDDWKRKYSNDDTRPVALPWFWEHYNPEEYSIWKVG
YKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDFAPA
FDVAPDWESYEYTKLDPTKEEDKEFVNNMWAWDKPVVVNGEDKEIVDGKVLK
Download sequence
Identical sequences B3LR10 N1P2A1 P36008 W7QWF1
YKL081W YKL081W 4932.YKL081W YKL081W YKL081W SCRT_03940 YKL081W YKL081W YKL081W YKL081W YKL081W YKL081W

Jump to [ Top of page · Domain architecture · Domain assignment details ]