SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YKL104C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL104C
Domain Number 1 Region: 349-717
Classification Level Classification E-value
Superfamily SIS domain 5.29e-96
Family double-SIS domain 0.00000045
Further Details:      
 
Domain Number 2 Region: 2-206,280-324
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.55e-53
Family Class II glutamine amidotransferases 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
side of membrane 1.701 22.27
external side of plasma membrane 1.827 22.27
cilium 1.573 10.65
ciliary part 1.844 10.65
ribonucleoprotein complex 1.414 8.37
cytoplasmic ribonucleoprotein granule 1.98 8.37
extracellular organelle 1.606 4.81
cell projection membrane 1.523 4.57
cytosol 1.301 4.08

Protein sequence

External link(s) Locus: YKL104C   Protein: S000001587
Sequence length 717
Comment GFA1 SGDID:S000001587, Chr XI from 245017-242864, reverse complement, Verified ORF, "Glutamine-fructose-6-phosphate amidotransferase, catalyzes the formation of glucosamine-6-P and glutamate from fructose-6-P and glutamine in the first step of chitin biosynthesis"
Sequence
MCGIFGYCNYLVERSRGEIIDTLVDGLQRLEYRGYDSTGIAIDGDEADSTFIYKQIGKVS
ALKEEITKQNPNRDVTFVSHCGIAHTRWATHGRPEQVNCHPQRSDPEDQFVVVHNGIITN
FRELKTLLINKGYKFESDTDTECIAKLYLHLYNTNLQNGHDLDFHELTKLVLLELEGSYG
LLCKSCHYPNEVIATRKGSPLLIGVKSEKKLKVDFVDVEFPEENAGQPEIPLKSNNKSFG
LGPKKAREFEAGSQNANLLPIAANEFNLRHSQSRAFLSEDGSPTPVEFFVSSDAASVVKH
TKKVLFLEDDDLAHIYDGELHIHRSRREVGASMTRSIQTLEMELAQIMKGPYDHFMQKEI
YEQPESTFNTMRGRIDYENNKVILGGLKAWLPVVRRARRLIMIACGTSYHSCLATRAIFE
ELSDIPVSVELASDFLDRKCPVFRDDVCVFVSQSGETADTMLALNYCLERGALTVGIVNS
VGSSISRVTHCGVHINAGPEIGVASTKAYTSQYIALVMFALSLSDDRVSKIDRRIEIIQG
LKLIPGQIKQVLKLEPRIKKLCATELKDQKSLLLLGRGYQFAAALEGALKIKEISYMHSE
GVLAGELKHGVLALVDENLPIIAFGTRDSLFPKVVSSIEQVTARKGHPIIICNENDEVWA
QKSKSIDLQTLEVPQTVDCLQGLINIIPLQLMSYWLAVNKGIDVDFPRNLAKSVTVE
Download sequence
Identical sequences A6ZZL3 B3LQZ2 B5VM55 C7GVK7 C8ZC71 E7KQZ7 E7QH68 G2WHT0 N1P050 P14742 V5RD14 W7PNV5 W7R999
YKL104C SCRT_03918 YKL104C YKL104C YKL104C YKL104C YKL104C YKL104C YKL104C 4932.YKL104C YKL104c___KOG1268 YKL104C YKL104C YKL104C tr|A6ZZL3|A6ZZL3_YEAS7 YKL104C YKL104C YKL104C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]